Recombinant Oryza sativa subsp. indica Defender against cell death 1 (DAD1)

Shipped with Ice Packs
In Stock

Description

Genetic Organization

The DAD1 gene in Oryza sativa subsp. indica represents a critical component of the plant's cellular machinery involved in regulating programmed cell death. The study of its orthologue in the rice gall midge (Orseolia oryzae) has revealed significant insights into the genetic structure of DAD1. The cDNA coding for the DAD1 orthologue in the rice gall midge (OoDAD1) consists of 339 nucleotides, organized into a specific genomic architecture comprising one intron of 85 base pairs and two exons measuring 208 and 131 nucleotides respectively . This genetic organization is consistent with the compact gene structure typically observed in many regulatory proteins involved in fundamental cellular processes such as apoptosis regulation. The gene's conservation across species suggests its evolutionary significance in maintaining cellular homeostasis across diverse organisms, from insects to plants.

Protein Structure and Conservation

Recombinant Oryza sativa subsp. indica Defender against cell death 1 (DAD1) belongs to a highly conserved family of proteins that function as inhibitors of programmed cell death. The commercial recombinant forms of this protein typically achieve a purity level greater than or equal to 85% as determined by SDS-PAGE analysis . When expressed as a recombinant protein with histidine tags, DAD1 produces a protein with an approximate molecular weight of 13.2 kDa, which includes the additional amino acids from the expression vector tags . Comparative sequence analysis has demonstrated remarkable conservation of this protein across species barriers. For instance, the deduced amino acid sequence of DAD1 orthologue from the rice gall midge (OoDAD1) exhibits a high degree of homology (94.6%) with the DAD1 orthologue from the Hessian fly (Mayetiola destructor), which is a major dipteran pest of wheat . This exceptional degree of sequence conservation underscores the fundamental importance of this protein in cellular processes across diverse organisms.

Anti-Apoptotic Functions

Defender against cell death 1 (DAD1) serves as a critical regulator of programmed cell death in both plant and animal systems. In its native context within Oryza sativa (rice), DAD1 functions as an inhibitor of apoptosis, preventing unwanted or premature cell death that could compromise plant development or response to stress . This protein appears to play a pivotal role in maintaining cellular integrity during various developmental stages and stress conditions. The anti-apoptotic function of DAD1 has been widely reported across diverse organisms, including Caenorhabditis elegans embryos and Bombyx mori (silkworm), indicating the evolutionarily conserved nature of this protein's function . In plant systems, DAD1 homologues have been identified and characterized in several species including Arabidopsis thaliana, pea, and rice, where they contribute to regulating programmed cell death during development and in response to environmental stressors . Research has also demonstrated the involvement of DAD1 in temperature-induced apoptotic cell death in various species such as Araneus ventricosus and Argopecten irradians, highlighting its role in stress response pathways .

Role in Plant-Insect Interactions

The significance of DAD1 extends beyond its cellular functions to play a crucial role in plant-insect interactions, particularly in the context of host resistance mechanisms. Studies involving the Asian rice gall midge (Orseolia oryzae) and rice plants have revealed fascinating insights into how DAD1 mediates these interactions. When the rice gall midge infests rice plants, two types of interactions can occur: compatible interactions leading to maggot survival, or incompatible interactions resulting in maggot mortality . In incompatible interactions with resistant rice varieties, the plant's defense mechanisms generate allelochemicals or defense molecules that initiate apoptosis within the feeding maggots. In response to this plant-induced stress, the maggots upregulate their DAD1 gene expression as a survival mechanism to counteract the apoptotic signals . This defensive upregulation is particularly pronounced in maggots feeding on resistant rice varieties compared to those feeding on susceptible varieties, suggesting that DAD1 plays a crucial role in the insect's attempt to overcome host plant resistance .

Differential Expression in Compatible and Incompatible Interactions

Research on the expression patterns of DAD1 has revealed significant differences in its regulation during compatible and incompatible interactions between the Asian rice gall midge and its rice host plants. In compatible interactions involving gall midge biotype 4 (GMB4) feeding on the susceptible rice variety Jaya, the expression level of DAD1 in the feeding maggots shows a gradual increase over time. Specifically, expression increases approximately 3-fold at 96 hours after infestation (hai) and reaches a peak of 3.5-fold at 96 hai when compared to expression levels at 24 hai . This gradual upregulation suggests a moderate stress response in the insect when feeding on susceptible hosts. In stark contrast, during incompatible interactions with resistant rice variety RP2068, the expression of DAD1 in the maggots exhibits a much more dramatic response. The expression levels show a steep increase of more than 8-fold at just 24 hai, and this elevated expression remains sustained at 48, 72, and 96 hai when compared with expression levels in maggots feeding on the susceptible variety at 24 hai . This dramatic and sustained upregulation of DAD1 in maggots feeding on resistant rice hosts indicates a significant stress response, likely triggered by the plant's defense molecules and the insect's inability to establish a proper feeding site.

Genomic Presence and Copy Number

Southern hybridization analysis has provided valuable insights into the genomic organization of DAD1 in the rice gall midge. Results indicate that DAD1 is present as a single copy in the genomes of the Asian rice gall midge biotypes (GMB) 1, 4, and 4M . This single-copy nature of the gene is consistent with its fundamental role in cellular processes and suggests that its function is tightly regulated at the genomic level. The presence of a single copy across different biotypes also indicates conservation of this gene within the species, further emphasizing its essential role in the insect's biology and survival strategies when encountering host resistance.

Expression Systems

The production of Recombinant Oryza sativa subsp. indica Defender against cell death 1 (DAD1) utilizes various expression systems to achieve optimal protein yield and functionality. Multiple expression platforms have been successfully employed for the recombinant production of this protein, each offering distinct advantages depending on the intended application. These systems include prokaryotic platforms such as Escherichia coli, which offer high yield and cost-effectiveness for basic research applications . For applications requiring post-translational modifications more similar to those in eukaryotic cells, expression systems such as yeast, baculovirus-infected insect cells, and various mammalian cell systems have been utilized . Additionally, cell-free expression systems have been employed for DAD1 production, providing advantages in terms of speed and avoiding potential toxicity issues that might arise with in vivo expression . The choice of expression system significantly influences the characteristics of the recombinant protein, including its folding, post-translational modifications, and biological activity, making the selection of an appropriate expression platform a critical consideration in DAD1 research and applications.

Purification and Characterization

Following expression, recombinant DAD1 typically undergoes rigorous purification processes to ensure high purity for downstream applications. Standard purification protocols involve affinity chromatography, particularly using Ni-NTA columns for His-tagged recombinant DAD1 . These purification methods consistently yield protein preparations with purity levels greater than or equal to 85% as determined by SDS-PAGE analysis . When expressed with appropriate tags, such as polyhistidine tags, in systems like E. coli using vectors such as pET 28a, the recombinant DAD1 protein produces a product with a molecular weight of approximately 13.2 kDa (including the seven histidine residues in the N-Terminal region) . The identity and integrity of the purified protein can be confirmed using anti-His antibodies through Western blot analysis . These purification and characterization steps are essential for ensuring the quality and consistency of recombinant DAD1 preparations used in research and potential biotechnological applications.

Hypersensitive Response Induction

One of the most intriguing discoveries regarding recombinant DAD1 from Oryza sativa is its ability to induce differential responses in susceptible versus resistant rice varieties. Research has demonstrated that when purified recombinant DAD1 protein is injected into rice seedlings, it triggers a hypersensitive response (HR) in resistant rice varieties such as RP2068 . This hypersensitive response, characterized by localized cell death at the injection site, represents a key plant defense mechanism against pathogens and pests. Notably, the spread of this hypersensitive response is more pronounced in resistant varieties injected with DAD1 compared to plants injected with control substances such as buffer or bovine serum albumin (BSA) . In stark contrast, no hypersensitive response is observed when the same recombinant DAD1 protein is injected into susceptible rice varieties like Jaya . This differential response suggests that resistant rice varieties possess specific recognition mechanisms that can detect insect-derived DAD1 and subsequently activate defense responses, while susceptible varieties lack this recognition capability.

Oxidative Burst and Defense Activation

The hypersensitive response induced by recombinant DAD1 in resistant rice varieties is accompanied by a significant oxidative burst, a hallmark of plant defense activation. This oxidative burst can be visualized through DAB (3,3′-diaminobenzidine) staining, which produces brown coloration in tissues experiencing increased peroxidase activity due to elevated production of reactive oxygen species . Experimental evidence has shown that DAB staining reveals brown coloration in the resistant rice variety Suraksha at 48 hours post-injection of recombinant DAD1, while in another resistant variety, RP2068, this response is observed at 72 hours post-injection . These temporal differences in the oxidative burst response between different resistant varieties suggest genotype-specific variations in defense activation kinetics, which may be attributed to the presence of different gall midge resistance genes in these varieties . The absence of similar responses in susceptible varieties further supports the hypothesis that rice resistance to gall midge involves specific recognition of insect-derived factors, including DAD1, followed by activation of defense responses that ultimately lead to insect mortality.

Tool for Studying Plant-Insect Interactions

Recombinant Oryza sativa subsp. indica Defender against cell death 1 (DAD1) has emerged as a valuable molecular tool for investigating the complex dynamics of plant-insect interactions, particularly in the context of host resistance mechanisms. The discovery that recombinant DAD1 can trigger a hypersensitive response specifically in resistant rice varieties provides researchers with a unique probe for dissecting the molecular recognition events underlying plant resistance to insect pests . By manipulating recombinant DAD1 and observing plant responses, scientists can gain insights into the receptor-ligand interactions that initiate defense signaling cascades in resistant plant varieties. Furthermore, the differential expression patterns of DAD1 in insects feeding on resistant versus susceptible hosts offers a window into the molecular adaptation strategies employed by pests when encountering host resistance . These applications make recombinant DAD1 an invaluable research tool for advancing our understanding of the molecular dialogue between plants and their insect pests, potentially leading to the development of novel pest management strategies based on enhanced plant resistance.

Potential for Crop Protection Strategies

The insights gained from studies involving recombinant DAD1 hold significant promise for developing innovative crop protection strategies. The identification of DAD1 as a potential insect-derived molecule that can be recognized by resistant plant varieties opens avenues for enhancing plant resistance through genetic engineering approaches . By understanding how plants recognize and respond to insect-derived factors like DAD1, researchers may be able to engineer or select for enhanced recognition capabilities in crop plants, thereby strengthening their natural defense mechanisms against insect pests. Additionally, the observation that DAD1 plays a critical role in insect survival when facing plant defenses suggests that this protein could potentially serve as a target for novel biopesticides designed to interfere with insect anti-apoptotic mechanisms . Such approaches could complement existing pest management strategies by providing more specific and environmentally friendly alternatives to conventional chemical pesticides, contributing to sustainable agricultural practices while reducing the environmental impact of crop protection measures.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, we recommend briefly centrifuging the vial to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. To enhance long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is selected during production. If you have a specific tag requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
DAD1; DAD-1; OsI_015174; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; Oligosaccharyl transferase subunit DAD1; Defender against apoptotic death 1 protein; Defender against cell death 1; DAD-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
Target Protein Sequence
MPRATSDAKLLIQSLGKAYAATPTNLKIIDLYVVFAVATALIQVVYMGIVGSFPFNSFLS GVLSCIGTAVLAVCLRIQVNKDNKEFKDLPPERAFADFVLCNLVLHLVIMNFLG
Uniprot No.

Target Background

Function
Defender against cell death 1 (DAD1) is a subunit of the oligosaccharyl transferase (OST) complex. This complex catalyzes the initial transfer of a specific glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This process, known as protein N-glycosylation, occurs cotranslationally. The OST complex associates with the Sec61 complex at the channel-forming translocon complex, which facilitates protein translocation across the endoplasmic reticulum (ER). The activity of the OST complex, and therefore N-glycosylation, requires the presence of all subunits.
Database Links
Protein Families
DAD/OST2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.