Recombinant Oryza sativa subsp. indica GDT1-like protein 1, chloroplastic (OsI_00941)

Shipped with Ice Packs
In Stock

Description

Functional Insights

OsI_00941 is a homolog of the GDT1/TMEM165 family, which regulates calcium (Ca²⁺) and manganese (Mn²⁺) homeostasis in cellular organelles . Key functional attributes include:

  • Ion Transport:

    • GDT1-like proteins exhibit Ca²⁺ and Mn²⁺ transport activity, with higher affinity for Ca²⁺ (Km=15.6±2.6 μMK_m = 15.6 \pm 2.6\ \mu M) than Mn²⁺ (Km=83.2±9.8 μMK_m = 83.2 \pm 9.8\ \mu M) .

    • In yeast, Gdt1 localizes to the Golgi and mitigates cytoplasmic Ca²⁺ overload during stress .

  • Role in Glycosylation:

    • Yeast studies show Gdt1 deficiency disrupts protein glycosylation, suggesting a link between ion homeostasis and post-translational modifications .

Research Applications

  • Ion Transport Studies: Used to investigate Ca²⁺/Mn²⁺ dynamics in plant organelles .

  • Protein Interaction Mapping: Identified interactors in rice Golgi pathways, though specific partners remain uncharacterized .

  • Biophysical Assays: ELISA kits and recombinant proteins enable quantitative analysis of expression and stability .

Future Directions

While OsI_00941’s role in rice remains understudied, its homology to yeast and human transporters suggests utility in:

  1. Engineering stress-tolerant crops via ion homeostasis modulation.

  2. Studying chloroplast-associated Ca²⁺ signaling in plants.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate your specific requirements. Please indicate your desired format in the order notes and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is dependent on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is established during production. If you have a specific tag preference, please inform us and we will prioritize its development for your order.
Synonyms
OsI_00941; GDT1-like protein 1, chloroplastic
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
58-341
Protein Length
Full Length of Mature Protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
OsI_00941
Target Protein Sequence
ASDEEGPPEPAGQGRGGGRAWPSLDASSCGLALAAAAGVLMLQGSQQALAGTEFMGMQDV VGDLGDISTGFASAFLLIFFSELGDRTFFIAALLAARNSGAIIFLGTFGALAVMTIISVV LGRAFHYVDGIIPFSFGGTDFPVDDFLAACLLVYYGVTTLLDAASGDEEKMNEEQEEAEL AVSKFLGNGAGIISAASTIASTFVLVFIAEWGDKSFFSTIALAAASSPLGVIAGSLAGHA VATLIAVLGGSLLGTFLSEKIVAYIGGSLFLAFAAVTLVEIVNS
Uniprot No.

Target Background

Protein Families
GDT1 family
Subcellular Location
Plastid, chloroplast membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for maintaining protein stability?

The recombinant OsI_00941 protein is supplied as a lyophilized powder, which should be stored at -20°C/-80°C upon receipt. For optimal stability:

  • Briefly centrifuge the vial prior to opening to ensure the contents are at the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended)

  • Aliquot for long-term storage at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles

Working aliquots can be stored at 4°C for up to one week . This storage protocol maintains protein stability by preventing aggregation and preserving the three-dimensional structure essential for functional studies.

How does OsI_00941 relate to other members of the GDT1/UPF0016 protein family?

OsI_00941 belongs to the UPF0016/GDT1 family, which includes members across diverse organisms from bacteria to higher eukaryotes. The protein family is characterized by:

  • Conservation of the consensus motif Glu-x-Gly-Asp-(Arg/Lys)-(Ser/Thr)

  • Involvement in cation homeostasis, particularly Ca²⁺ and Mn²⁺

  • Localization to membrane compartments (Golgi in yeast, chloroplast in OsI_00941)

The human ortholog TMEM165 has been linked to Congenital Disorders of Glycosylation (CDGs) when specific mutations occur. The yeast homolog Gdt1p interacts genetically with the Ca²⁺-Mn²⁺ P-type ATPase Pmr1p, suggesting conservation of function in Ca²⁺ homeostasis across species . This evolutionary conservation indicates the fundamental importance of this protein family in cellular physiology and makes OsI_00941 valuable for comparative studies of plant-specific adaptations.

What experimental approaches can validate the ion transport function of OsI_00941?

To validate the hypothesized ion transport function of OsI_00941, researchers should employ a multi-faceted experimental strategy:

  • Electrophysiological studies: Whole-cell patch-clamp analyses similar to those performed on TMEM165 in HeLa cells can determine ion selectivity and transport kinetics. This requires heterologous expression in a suitable cell system that lacks endogenous transporters with similar properties .

  • Radioactive ion accumulation assays: Using ⁴⁵Ca²⁺ to track ion movement across membranes in reconstituted proteoliposomes containing purified OsI_00941 or in chloroplasts isolated from transgenic plants with modified OsI_00941 expression levels.

  • Site-directed mutagenesis: Targeted modification of the conserved Glu-x-Gly-Asp-(Arg/Lys)-(Ser/Thr) motif residues to assess their contribution to ion transport activity.

  • Yeast complementation experiments: Testing whether OsI_00941 can rescue phenotypes in yeast strains with deletions in GDT1 and/or PMR1 genes, particularly focusing on sensitivity to Ca²⁺ levels and cell wall integrity challenges .

  • FRET-based calcium sensors: Engineering chimeric proteins combining OsI_00941 with fluorescent calcium indicators to monitor real-time changes in ion concentrations within chloroplast compartments.

These approaches will provide complementary evidence for the ion transport function and specificity of OsI_00941 in different experimental contexts.

How does OsI_00941 interact with other proteins in the calcium homeostasis pathway of rice chloroplasts?

Based on the established interactions of GDT1 family proteins in other organisms, several experimental approaches can elucidate the interaction network of OsI_00941:

  • Co-immunoprecipitation (Co-IP) studies: Similarly to how TSHR-CD40 protein-protein interactions were detected , antibodies against OsI_00941 can be used to pull down interacting proteins from chloroplast lysates, followed by mass spectrometry identification.

  • Yeast two-hybrid screens: Using OsI_00941 as bait to identify interacting partners from a rice cDNA library.

  • Bimolecular Fluorescence Complementation (BiFC): To visualize protein interactions in planta by fusing potential interacting partners with complementary fragments of fluorescent proteins.

  • Genetic interaction mapping: Creating transgenic rice lines with modifications in OsI_00941 and potential interacting partners to identify synthetic phenotypes that suggest functional relationships.

The interaction data from yeast Gdt1p with Pmr1p suggests that OsI_00941 may interact with rice homologs of P-type ATPases involved in ion transport . Additionally, given its chloroplast localization, OsI_00941 likely interacts with proteins involved in photosynthesis and photorespiration, making it a potential target for chloroplast engineering approaches aimed at improving photosynthetic efficiency .

What are the implications of OsI_00941 for chloroplast synthetic biology applications?

OsI_00941's chloroplastic localization positions it as a valuable component for chloroplast synthetic biology applications:

  • Metabolic engineering: As a membrane protein involved in ion homeostasis, OsI_00941 could be engineered to optimize intrachloroplast cation concentrations for enhanced enzyme activity in synthetic pathways.

  • Stress tolerance: Modifying OsI_00941 expression or activity might enhance plant tolerance to environmental stresses that disrupt ion homeostasis, such as salinity or heat stress.

  • Photosynthetic efficiency: Given the importance of calcium signaling in regulating photosynthesis, engineered variants of OsI_00941 could potentially enhance carbon fixation efficiency.

  • Integration into synthetic pathways: Within the context of synthetic chloroplast pathways like the chloroplast-based synthetic photorespiration pathway that demonstrated a twofold increase in biomass production in Chlamydomonas reinhardtii , OsI_00941 could serve as a supporting module for maintaining optimal ionic conditions.

To apply OsI_00941 in chloroplast synthetic biology, researchers should consider integrating it within established cloning standards such as the Phytobrick standard mentioned in the literature , which would facilitate its incorporation into complex genetic constructs for chloroplast transformation.

What are the best approaches for functional characterization of OsI_00941 in heterologous expression systems?

For effective functional characterization of OsI_00941 in heterologous systems, researchers should consider:

  • Expression system selection: While E. coli is used for recombinant production , functional studies may require eukaryotic systems with appropriate post-translational modifications and membrane architecture. Consider:

    • Yeast (S. cerevisiae or P. pastoris) for complementation studies

    • Insect cells (Sf9) for membrane protein expression

    • Plant-based transient expression systems (tobacco)

  • Protein tagging strategies:

    • N-terminal versus C-terminal tags based on predicted topology

    • Fluorescent protein fusions for localization studies

    • Split reporter assays for interaction studies

  • Functional assays:

    • Ion transport using reconstituted proteoliposomes

    • Growth complementation in ion transport-deficient strains

    • Ion-sensitive fluorescent probes to measure transport activity

  • Expression optimization table:

ParameterE. coliYeastInsect CellsPlant Cells
Codon optimizationEssentialBeneficialBeneficialOptional
Temperature16-25°C25-30°C27°C22-25°C
Induction methodIPTGMethanol/GalactoseViral infectionAgrobacterium
Extraction bufferTris/PBS pH 8.0 with detergentsPhosphate buffer with glycerolPhosphate buffer with mild detergentsHEPES buffer with plant protease inhibitors
Yield expectationsHigh quantity, variable activityModerate quantity, better foldingLower quantity, high qualityLow quantity, native conformation

This multi-system approach provides complementary data on protein function while minimizing system-specific artifacts .

How can researchers accurately assess the calcium transport activity of OsI_00941?

To quantitatively assess calcium transport activity of OsI_00941, researchers should implement:

  • Proteoliposome-based transport assays:

    • Purify recombinant OsI_00941 using the His-tag

    • Reconstitute into liposomes with defined lipid composition

    • Establish calcium gradients using calcium buffers

    • Monitor calcium flux using calcium-sensitive fluorescent dyes or radioactive 45Ca2+

    • Compare transport rates with and without ionophores/inhibitors

  • Microscopy-based approaches in live cells:

    • Express OsI_00941 in appropriate cell systems

    • Use genetically encoded calcium indicators targeted to the same compartment

    • Perform time-lapse imaging to monitor calcium flux

    • Calculate transport kinetics using calibration curves

  • In vivo functional complementation:

    • Express OsI_00941 in yeast strains lacking GDT1

    • Assess rescue of calcium-dependent phenotypes

    • Perform growth assays under calcium stress conditions

    • Compare with known calcium transporters as positive controls

  • Data analysis considerations:

    • Calculate initial rates to determine Km and Vmax parameters

    • Assess ion selectivity by competition experiments

    • Account for background transport in control preparations

    • Consider counter-ion effects in transport measurements

These methodologies are adaptations of approaches used to characterize calcium transport by other GDT1 family members, particularly in yeast where genetic interactions with Ca2+-Mn2+ P-type ATPase Pmr1p have been established .

What techniques are most effective for studying OsI_00941 localization and trafficking in plant cells?

For accurate determination of OsI_00941 localization and trafficking in plant cells, the following techniques are recommended:

  • Confocal microscopy of fluorescent protein fusions:

    • Generate N- and C-terminal GFP/mCherry fusions of OsI_00941

    • Express in rice protoplasts or stable transgenic lines

    • Co-localize with established chloroplast markers

    • Perform time-lapse imaging to track protein movement

  • Immunogold electron microscopy:

    • Develop specific antibodies against OsI_00941 or utilize anti-His tag antibodies

    • Prepare ultrathin sections of rice chloroplasts

    • Localize OsI_00941 at the ultrastructural level

    • Quantify distribution across chloroplast compartments

  • Biochemical fractionation:

    • Isolate intact chloroplasts from plant tissue

    • Separate thylakoid, stromal, and envelope fractions

    • Detect OsI_00941 by western blotting

    • Assess purity of fractions with compartment-specific markers

  • FRAP (Fluorescence Recovery After Photobleaching) analysis:

    • Use GFP-tagged OsI_00941 to measure protein mobility

    • Calculate diffusion coefficients in different membrane compartments

    • Compare mobility under different environmental conditions

  • Inducible expression systems:

    • Generate constructs with controlled expression timing

    • Track newly synthesized protein trafficking to final destination

    • Identify factors affecting localization efficiency

These approaches would complement similar studies conducted on other chloroplast proteins and could be integrated into broader chloroplast engineering initiatives as described in research on Chlamydomonas reinhardtii .

How can researchers address issues with low expression or insolubility of recombinant OsI_00941?

When encountering low expression or insolubility issues with recombinant OsI_00941, consider the following solutions:

  • Expression optimization:

    • Adjust induction conditions (temperature, inducer concentration, duration)

    • Test multiple E. coli strains (BL21(DE3), C41/C43, Rosetta)

    • Co-express with molecular chaperones (GroEL/GroES, DnaK/DnaJ)

    • Use auto-induction media instead of IPTG induction

  • Solubilization strategies:

    • Screen detergent panel for optimal extraction (see table below)

    • Try mild solubilization conditions (e.g., higher pH, lower ionic strength)

    • Add stabilizing agents (glycerol, specific lipids, calcium)

  • Protein engineering approaches:

    • Generate fusion constructs with solubility-enhancing partners (MBP, SUMO)

    • Create truncation variants to identify soluble domains

    • Modify predicted surface-exposed hydrophobic residues

  • Detergent screening table:

DetergentCMC (mM)Concentration RangeProtein StabilityMembrane Mimetic Quality
DDM0.170.5-2%HighExcellent
LMNG0.010.01-0.05%Very HighExcellent
Digitonin0.50.5-1%HighGood
Triton X-1000.20.5-2%ModerateFair
SDS8.00.1-1%LowPoor
  • Alternative expression systems:

    • Consider cell-free expression systems with supplied lipids/detergents

    • Try eukaryotic expression in yeast or insect cells for complex membrane proteins

    • Develop plant-based expression for chloroplast proteins

These approaches address the challenges commonly encountered with membrane proteins while maintaining the His-tag functionality for purification as specified in the product information .

What strategies can help overcome difficulties in detecting calcium transport activity in experimental systems?

When calcium transport activity of OsI_00941 is difficult to detect, consider these troubleshooting strategies:

  • Assay optimization:

    • Adjust buffer composition (pH, ionic strength, competing ions)

    • Try different calcium concentrations spanning physiological range

    • Include proper positive controls (known calcium transporters)

    • Eliminate background activity with specific inhibitors

  • Signal-to-noise enhancement:

    • Use higher-sensitivity calcium indicators (Fura-2, Fluo-4)

    • Optimize protein-to-lipid ratios in proteoliposomes

    • Employ ratiometric measurements to reduce artifacts

    • Increase temporal resolution of measurements

  • Counter-ion considerations:

    • Test different counter-ions if OsI_00941 functions as an exchanger

    • Pre-establish ion gradients that might drive transport

    • Consider coupled transport with H+ or other ions

  • Protein quality assessment:

    • Verify proper folding using circular dichroism

    • Assess oligomeric state using size exclusion chromatography

    • Confirm membrane integration using protease protection assays

  • Transport direction:

    • Test both calcium efflux and influx configurations

    • Consider that OsI_00941 may transport calcium in a direction contrary to expectations based on yeast Gdt1p function

This systematic approach draws from established methodologies used to characterize other calcium transporters, including the yeast Gdt1p protein which has been shown to be involved in Ca2+ homeostasis through genetic interaction studies with Pmr1p .

How should researchers interpret conflicting results between in vitro and in vivo studies of OsI_00941 function?

When faced with discrepancies between in vitro and in vivo functional studies of OsI_00941, apply this analytical framework:

  • Systematic comparison of experimental conditions:

    • Document differences in protein preparation methods

    • Compare buffer compositions, particularly ion concentrations

    • Assess temperature, pH, and redox conditions across experiments

    • Evaluate the presence/absence of regulatory factors in different systems

  • Context-dependent function analysis:

    • Consider that membrane environment affects transport activity

    • Recognize that in vivo systems contain interacting partners absent in vitro

    • Examine potential post-translational modifications present only in vivo

    • Assess if protein concentration differences affect oligomerization state

  • Resolution through complementary approaches:

Observation TypeIn Vitro FindingIn Vivo FindingReconciliation Approach
Transport rateFastSlowTest for regulatory inhibition in vivo
Ion selectivityBroadNarrowExamine competing ions present in cellular context
Activation conditionsConstitutiveRegulatedIdentify potential regulatory proteins/molecules
LocalizationSingle compartmentMultiple compartmentsInvestigate trafficking regulation and protein isoforms
  • Functional redundancy considerations:

    • Assess presence of compensatory mechanisms in vivo

    • Investigate genetic interactions with related transporters

    • Consider studying double or triple mutants to overcome redundancy

  • Evolutionary context:

    • Compare function with orthologs from other species

    • Analyze if discrepancies reflect adaptation to specific cellular contexts

This approach draws from the broader understanding of the GDT1 family of proteins and their established roles in Ca2+ homeostasis, particularly from studies of yeast Gdt1p and its genetic interactions with the Ca2+-Mn2+ P-type ATPase Pmr1p .

What are the future research directions for OsI_00941 and other GDT1-like proteins?

The study of OsI_00941 and related GDT1-like proteins is positioned at the intersection of several exciting research frontiers:

  • Structural biology advancements: With improvements in protein structure prediction technologies like AlphaFold2, detailed structural analysis of OsI_00941 will enhance understanding of its transport mechanism and facilitate rational engineering approaches .

  • Chloroplast synthetic biology: OsI_00941 represents a valuable component for emerging chloroplast engineering platforms, potentially contributing to enhanced photosynthetic efficiency and stress tolerance in crop plants .

  • Evolutionary conservation: Comparative analysis across species will continue to reveal the core functions and adaptations of GDT1-like proteins, particularly focusing on their roles in different cellular compartments (Golgi in yeast versus chloroplast in plants).

  • Integration with calcium signaling networks: Further research will likely reveal how OsI_00941 contributes to calcium signaling networks that coordinate chloroplast function with cellular metabolism and environmental responses.

  • Biotechnological applications: Building on established roles in cation homeostasis, engineered variants of OsI_00941 may contribute to biofortification strategies or enhanced abiotic stress tolerance in rice and other crops.

These research directions reflect the growing importance of understanding membrane protein function in plant biology and the potential applications in addressing agricultural challenges through targeted chloroplast engineering .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.