Recombinant Oryza sativa subsp. indica Magnesium transporter MRS2-B (MRS2-B)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MRS2-B; OsI_23924; Magnesium transporter MRS2-B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-436
Protein Length
full length protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
MRS2-B
Target Protein Sequence
MSAAAASSAAGDSAKQPLLHHQRGNPPHVASVSSPSLPSAPPGALAGGRRFPGGLDVPNL KKRGGGTRSWIRVEAATASVQTLEVDKATMMRRCELPARDLRLLDPLFVYPSTILGRERA IVVNLEQIRCVITADEVLLLNSLDSYVLQYAAELQRRLLQRAEGDELPFEFRALELALEA ACSFLDAQAAELEIEAYPLLDELTSKISTLNLERVRRLKSRLVALTRRVQKVRDEIEQLM DDDGDMAEMYLSEKKLRTEASFYGDQSMLGYNSVGDGTSFSAPVSPVSSPTESRKLEKAF SLCRSRHDSVKSSDNTATEHIQELEMLLEAYFVVIDSTLNKLTSLKEYIDDTEDFINIQL DNVRNQLIQFELLLTTATFVVAIFGVVAGIFGMNFETSVFSIQNAFQWVLIITGVIGAFI FCGFLWFFKYKRLMPL
Uniprot No.

Target Background

Function
Magnesium transporter potentially mediating magnesium influx.
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35.5) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the MRS2/MGT gene family and how is MRS2-B characterized in Oryza sativa subsp. indica?

The MRS2/MGT gene family belongs to the superfamily of CorA-MRS2-ALR-type membrane proteins that function as magnesium transporters in plants. These proteins are characterized by a highly conserved GMN (Glycine-Methionine-Asparagine) tripeptide motif at the end of the first of two C-terminal transmembrane domains . In Arabidopsis thaliana, this gene family comprises 10 members, which were initially named AtMRS2 and alternatively AtMGT for magnesium transport .

In Oryza sativa subsp. indica, MRS2-B is one of several magnesium transporters that likely plays a role in magnesium uptake and distribution within the plant. Based on homology with other plant MRS2 transporters, MRS2-B is predicted to be involved in magnesium homeostasis, which is essential for numerous physiological processes including photosynthesis, enzyme activation, and nucleic acid synthesis. Specific characterization of MRS2-B in rice indicates it shares the conserved structural features of the MRS2/MGT family while exhibiting tissue-specific expression patterns that may differ from its homologs in other species.

What methods are available for studying magnesium transport activity of recombinant MRS2-B proteins?

Several methodologies can be employed to study the magnesium transport activity of recombinant MRS2-B proteins:

  • Heterologous Expression Systems: The mag-fura-2 fluorescence-based assay has been successfully used to directly measure Mg²⁺ uptake into mitochondria of Saccharomyces cerevisiae expressing MRS2 proteins . This system allows for real-time measurement of magnesium transport across biological membranes. Mag-fura-2 is a UV-excitable, Mg²⁺-dependent fluorescent indicator that undergoes a blue shift from 380 to 340 nm upon Mg²⁺ binding .

  • Complementation Assays: Functional characterization can be performed by expressing recombinant MRS2-B in yeast mrs2 mutants deficient in magnesium transport. The ability of the rice MRS2-B to restore growth under magnesium-limiting conditions provides evidence of its transport function .

  • Direct Uptake Measurements: Isolated organelles (mitochondria, chloroplasts) loaded with fluorescent magnesium indicators can be used to measure uptake upon application of increasing external Mg²⁺ concentrations .

  • Electrophysiological Methods: Patch-clamp techniques can be used to measure ion currents across membranes containing recombinant MRS2-B proteins.

How does MRS2-B expression respond to magnesium availability in rice?

Like other members of the MRS2/MGT family, MRS2-B expression is likely regulated by magnesium availability, though specific data for rice MRS2-B must be experimentally determined. In related studies, when magnesium is limited, certain MRS2/MGT transporters show increased expression to enhance magnesium uptake capability. Conversely, high magnesium conditions may downregulate expression of these transporters to prevent toxicity.

To study expression responses, researchers typically employ:

  • qRT-PCR Analysis: This technique allows quantification of MRS2-B transcript levels under different magnesium concentrations.

  • Promoter-Reporter Fusions: By fusing the MRS2-B promoter to a reporter gene such as GUS (β-glucuronidase), researchers can visualize expression patterns in different tissues and under varying magnesium conditions .

  • Western Blotting: Using specific antibodies against MRS2-B, protein levels can be quantified under different conditions.

  • RNA-Seq Analysis: This approach provides a comprehensive view of transcriptional changes, including MRS2-B and related genes, in response to varying magnesium availability.

How can CRISPR/Cas9 gene editing be used to study MRS2-B function in rice?

CRISPR/Cas9 gene editing offers powerful approaches to study MRS2-B function in rice through several strategies:

  • Complete Gene Knockout: Creating null mutants by introducing frameshift mutations or large deletions in the MRS2-B coding sequence. This approach was successfully employed for studying type-B response regulators in rice, revealing their roles in growth, development, and cytokinin signaling pathways .

  • Domain-Specific Mutations: Targeted modification of specific domains, such as the GMN motif, to assess their functional importance without eliminating the entire protein.

  • Promoter Editing: Modifying the promoter region to alter expression patterns or levels.

  • Tag Integration: Inserting reporter or affinity tags for tracking protein expression and localization.

The experimental design for CRISPR/Cas9 editing of MRS2-B should include:

StepDescriptionCritical Considerations
1sgRNA designTarget specificity, efficiency prediction, avoiding off-targets
2Vector constructionAppropriate promoters, selectable markers
3Rice transformationAgrobacterium-mediated or biolistic methods
4Transformant selectionAntibiotic/herbicide selection, PCR screening
5Mutation verificationSequencing, protein expression analysis
6Phenotypic analysisGrowth, development, magnesium content measurement
7Complementation testingExpression of wild-type MRS2-B to confirm phenotype causality

When designing a CRISPR experiment, it is crucial to follow a structured approach as outlined in the experimental design methodology , which includes clearly defining variables:

  • Independent variable: MRS2-B modification (knockout, specific mutation)

  • Dependent variables: Plant growth parameters, magnesium content, stress responses

  • Controlled variables: Growth conditions, genetic background, developmental stage

How can researchers design experiments to measure the effects of MRS2-B expression levels on rice growth and development?

To assess the effects of MRS2-B expression levels on rice growth and development, researchers should implement a comprehensive experimental design that combines molecular, physiological, and phenotypic analyses:

  • Generation of Transgenic Lines:

    • Overexpression lines (OX) using a constitutive promoter like CaMV 35S

    • RNAi or CRISPR/Cas9 knockout lines

    • Tissue-specific expression using appropriate promoters

  • Experimental Setup:
    Following proper experimental design principles , researchers should:

    • Clearly define independent variables (MRS2-B expression levels)

    • Identify dependent variables (growth parameters, magnesium content)

    • Control all other variables (growth conditions, watering regime)

    • Formulate a testable hypothesis (e.g., "If MRS2-B expression is increased, then magnesium content will increase because MRS2-B facilitates magnesium transport")

    • Include appropriate controls (wild-type plants, empty vector controls)

  • Growth Parameters to Measure:

    • Shoot and root length

    • Biomass accumulation

    • Leaf number and area

    • Time to flowering

    • Yield components

  • Physiological Measurements:

    • Magnesium content in different tissues

    • Photosynthetic efficiency

    • Response to magnesium limitation or excess

    • Cell size and number (histological analysis)

  • Molecular Analyses:

    • Verification of MRS2-B expression levels (qRT-PCR, Western blot)

    • Transcriptome analysis to identify affected pathways

    • Metabolite profiling

What methods are available for studying the kinetic properties of recombinant MRS2-B protein?

Understanding the kinetic properties of MRS2-B is essential for characterizing its transport mechanism. Several approaches can be employed:

  • Radiotracer Flux Assays: Using isotopically labeled magnesium (²⁸Mg) to measure transport rates across membranes containing recombinant MRS2-B.

  • Fluorescence-Based Assays: The mag-fura-2 system allows real-time measurement of Mg²⁺ uptake into organelles. This approach has been successfully used with plant MRS2 proteins expressed in yeast . Mag-fura-2 undergoes a measurable spectral shift when bound to Mg²⁺, allowing quantification of transport rates .

  • Electrophysiological Techniques: Patch-clamp recordings can measure ion currents mediated by MRS2-B in cellular or artificial membrane systems.

  • Isothermal Titration Calorimetry (ITC): This technique can determine binding affinities and thermodynamic parameters of Mg²⁺ interaction with purified MRS2-B.

  • Competition Assays: Testing transport inhibition by other divalent cations can provide insights into substrate specificity.

For determining basic kinetic parameters, researchers should:

  • Express and purify functional recombinant MRS2-B

  • Reconstitute the protein in liposomes or use a heterologous expression system

  • Measure transport rates at varying substrate concentrations

  • Analyze data to determine parameters such as Km, Vmax, and transport efficiency

A typical kinetic characterization would include:

ParameterExperimental ApproachExpected Range
KmTransport assays with varying [Mg²⁺]0.1-5 mM
VmaxTransport assays at saturating [Mg²⁺]Protein-specific
Ion selectivityTransport assays with competing ionsMg²⁺ > Ni²⁺ > Co²⁺
pH dependenceTransport assays at different pHpH 6.0-8.0
Temperature dependenceTransport assays at different temperatures15-40°C

How can researchers detect and resolve data contradictions in MRS2-B functional studies?

When studying complex biological systems like MRS2-B transporters, researchers may encounter contradictory data. Addressing these contradictions requires systematic approaches:

  • Identify Potential Sources of Discrepancy:

    • Experimental conditions (temperature, pH, buffer composition)

    • Protein variants or isoforms

    • Post-translational modifications

    • Heterologous expression system differences

    • Technical limitations of measurement methods

  • Implement Metamorphic Testing:
    Metamorphic testing (MT) can help identify inconsistencies by checking whether test results satisfy expected data relations . For MRS2-B research, this could involve:

    • Testing relations between transport rates and substrate concentrations

    • Comparing results from different experimental approaches

    • Validating that results follow expected physical principles (e.g., transport saturation)

  • Cross-Validation Approaches:

    • Use multiple independent methods to measure the same parameter

    • Test in different expression systems

    • Compare in vitro and in vivo results

    • Perform complementation tests with different MRS2 family members

  • Statistical Analysis:

    • Apply appropriate statistical tests to determine if differences are significant

    • Consider using Bayesian approaches to integrate multiple data sources

    • Implement pattern analysis techniques to identify systematic errors

  • Biological Validation:

    • Verify functional complementation in mrs2 mutants

    • Correlate in vitro transport activity with in vivo phenotypes

    • Test predictions based on structural models of MRS2-B

How does MRS2-B from Oryza sativa subsp. indica compare to homologous proteins in other plants?

Comparing MRS2-B from Oryza sativa subsp. indica with homologous proteins can provide valuable insights into conserved functions and species-specific adaptations:

What roles might MRS2-B play in rice development compared to other magnesium transporters?

Understanding the specific developmental roles of MRS2-B requires comparing its functions with other magnesium transporters in rice:

  • Developmental Expression Patterns:
    Like the type-B response regulators studied in rice, which play key roles in growth, development, and cytokinin signaling pathways , MRS2-B may show developmental stage-specific expression patterns that indicate its specialized functions.

  • Tissue-Specific Functions:
    Based on knowledge of MRS2/MGT family members in Arabidopsis, with six expressed in root tissues , rice MRS2-B may have specific roles in certain tissues that contribute to magnesium homeostasis during development.

  • Response to Environmental Conditions:
    MRS2-B may be differentially regulated under various environmental conditions compared to other magnesium transporters, suggesting specialized roles in stress responses.

  • Interaction with Signaling Pathways:
    Similar to how type-B response regulators in rice interact with cytokinin signaling pathways affecting leaf and root growth, inflorescence architecture, and flower development , MRS2-B may interact with specific signaling networks during development.

  • Functional Redundancy and Specialization:
    Analysis of higher-order mutants in rice has revealed both functional overlap and subfunctionalization within gene families . Similarly, MRS2-B likely shares some redundant functions with other MRS2/MGT transporters while also having unique specialized roles.

What emerging technologies could enhance our understanding of MRS2-B function in rice?

Several cutting-edge technologies hold promise for advancing our understanding of MRS2-B function:

  • CRISPR Base Editing and Prime Editing:
    These advanced gene editing techniques allow for precise nucleotide changes without double-strand breaks, enabling the creation of specific mutations in MRS2-B to study structure-function relationships.

  • Single-Cell Omics:
    Single-cell transcriptomics, proteomics, and metabolomics can reveal cell type-specific expression and function of MRS2-B in different rice tissues.

  • Live-Cell Imaging with Magnesium-Specific Sensors:
    Genetically encoded magnesium sensors coupled with advanced microscopy techniques can provide real-time visualization of magnesium dynamics in relation to MRS2-B activity.

  • Cryo-EM Structure Determination:
    Determining the three-dimensional structure of MRS2-B at atomic resolution can provide insights into its transport mechanism and substrate specificity.

  • Synthetic Biology Approaches:
    Engineering MRS2-B with novel properties or regulatory elements can help dissect its function and potentially improve magnesium use efficiency in crops.

How might MRS2-B research contribute to improving stress tolerance in rice crops?

Research on MRS2-B has significant potential applications for improving stress tolerance in rice:

  • Magnesium Deficiency Tolerance:
    Understanding MRS2-B function could lead to strategies for enhancing magnesium uptake and utilization efficiency under limiting conditions.

  • Heat and Drought Stress Responses:
    Since magnesium plays crucial roles in photosynthesis and enzyme function, optimizing MRS2-B activity might improve plant performance under heat and drought stress.

  • Salinity Tolerance:
    Magnesium transport and homeostasis are affected by high sodium levels. Engineered MRS2-B variants might help maintain proper magnesium status under saline conditions.

  • Integration with Other Nutrient Pathways:
    MRS2-B research could reveal interactions between magnesium and other nutrient homeostasis networks, leading to more comprehensive strategies for improving plant nutrition.

  • Biofortification Applications: Manipulating MRS2-B expression or activity could potentially enhance magnesium content in rice grains, addressing human micronutrient deficiencies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.