Recombinant Oryza sativa subsp. indica Magnesium transporter MRS2-C (H0311C03.3, OsI_16518)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
H0311C03.3; OsI_16518; Magnesium transporter MRS2-C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-428
Protein Length
full length protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
H0311C03.3
Target Protein Sequence
MDHDPKERLLLPPRAAAAAAANGPHRRAAPAAGGGGGGVAIDVHGLKRRGGGRRSWVRVD AATGASEAVEVAKPALMRRLDLPARDLRLLDPLFVYPSAILGRERAVVCNLERIRCIITA DEALILRDPDVAGGGAETEEAVRRYVAELQRRLVDRADDLPFEFIALEVALEAACSFLDA QAVELEADAYPLLDELTTKISTLNLERVRRLKSKLVALTRRVQKVRDEIEQLMDDDGDMA EMYLTEKKRRMEASLLEEQAFQGMGNSGFGSSFSAPVSPVSSPPASRRLEKELSFARSRH DSFKSADSSQYSIEELEMLLEAYFVVIDYTLSKLTSLKEYIDDTEDFINIQLDNVRNQLI QFELLLTTATFVVAIFGVVSGVFGMNFEVDLFNVPHAFEWTLVITGVCGLVIFCCFIWYF KKRRFFPL
Uniprot No.

Target Background

Function
A magnesium transporter potentially mediating magnesium influx.
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35.5) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the MRS2-C transporter and how does it relate to the broader MRS2 family?

MRS2-C (H0311C03.3, OsI_16518) is a magnesium transporter belonging to the CorA/MRS2/ALR-type family of membrane proteins found in rice (Oryza sativa subsp. indica). This transporter is part of a larger family of magnesium transporters (MGTs) that regulate magnesium absorption, transport, and redistribution in higher plants .

The MRS2 family in rice contains multiple members that have been phylogenetically classified into three main clades based on their conserved domains:

  • CorA-like

  • NIPA (Non-Imprinted in Prader-Willi/Angelman syndrome)

  • MMgT (Membrane Magnesium Transporter)

MRS2-C specifically belongs to the CorA-like clade, which is characterized by specific transmembrane domains and a conserved GMN tripeptide motif near the C-terminal that is critical for magnesium transport function .

How does the MRS2-C transporter function in magnesium transport?

MRS2-C functions as a selective magnesium channel in the cell membrane, facilitating the transport of Mg²⁺ ions across cellular membranes. The transport mechanism involves:

  • Recognition and binding of hydrated Mg²⁺ ions

  • Partial dehydration of the ion as it enters the channel

  • Transport through the membrane via the channel

  • Release of Mg²⁺ on the other side of the membrane

The transport process is influenced by:

  • Membrane potential

  • Magnesium concentration gradient

  • Presence of other competing cations

  • Conformational changes between open and closed states

Studies on eukaryotic MRS2 proteins reveal that Mg²⁺ binding to the amino terminal domain can disrupt homomeric interactions and inhibit mitochondrial Mg²⁺ uptake as a negative feedback mechanism . This suggests that MRS2-C likely functions under similar regulatory controls, with its activity modulated by Mg²⁺ availability.

What role does MRS2-C play in rice development and stress responses?

MRS2-C plays crucial roles in:

  • Plant Development: RNA-seq data analysis shows that some CorA-like MGT genes are expressed in multiple rice tissues, indicating their importance during rice development .

  • Stress Responses: Multiple studies have shown that magnesium transporters are involved in various stress responses:

    • Under aluminum stress, the expression of specific MGT genes increases to enhance magnesium absorption by roots, improving aluminum stress resistance .

    • Under salt stress, four OsMGT genes exhibit different expression patterns in salt-sensitive and salt-tolerant rice genotypes, suggesting MGTs' involvement in salt stress responses .

  • Magnesium Homeostasis: MRS2-C helps maintain proper magnesium levels in different plant tissues, which is essential for numerous metabolic activities including chlorophyll formation and enzymatic reactions .

A gene expression analysis showed that under salt stress, several MGT family members displayed tissue-specific expression patterns, highlighting their specialized roles in maintaining ion balance during environmental challenges .

How can recombinant MRS2-C be efficiently expressed and purified for functional studies?

Recommended Expression Protocol:

  • Vector Selection: Use a pET-22b or equivalent expression vector with a C-terminal His-tag for easier purification .

  • Expression System: Express the recombinant protein in E. coli BL21(DE3) cells, which have been successfully used for similar transporters .

  • Culture Conditions:

    • Grow cells in LB medium supplemented with ampicillin (50 μg/ml)

    • Induce expression with IPTG (10 μM) when OD reaches 0.65

    • Express at 37°C for optimal yield

  • Purification Strategy:

    • Harvest cells and resuspend in lysis buffer containing 5 mM MgCl₂

    • Collect membranes through ultracentrifugation at 165,000 g

    • Solubilize membranes using 1% DDM (n-dodecyl-β-maltoside)

    • Purify using IMAC (immobilized metal affinity chromatography)

    • Apply to a size exclusion chromatography column for further purification

  • Buffer Conditions:

    • Use Tris-based buffer with 0.05% DDM and either 2 mM MgCl₂ (for closed state) or 2 mM EDTA (for open state)

This protocol has been optimized based on successful purification of similar magnesium transporters and should yield functional protein suitable for structural and functional studies.

What methods can be used to assess MRS2-C transport activity in vitro?

Several complementary approaches can be used to evaluate MRS2-C transport activity:

1. Functional Complementation Assay in Microbial Systems:

  • Transform MRS2-deficient yeast strains or E. coli MM281 strain with MRS2-C expression constructs

  • Assess growth recovery on media with limited magnesium

  • Compare growth rates between transformed cells and controls at different Mg²⁺ concentrations

2. Ni²⁺ Sensitivity Assay:

  • Express MRS2-C in E. coli cells

  • Spot serial dilutions on plates containing various concentrations of Ni²⁺

  • Ni²⁺ can compete with Mg²⁺ for transport, causing toxicity in cells expressing functional Mg²⁺ transporters

  • Compare growth inhibition between control and MRS2-C expressing cells

3. Limited Proteolysis Assay:

  • Purify MRS2-C protein (2 mg/ml stock solution)

  • Incubate with varying amounts of Mg²⁺ or EDTA

  • Add trypsin or chymotrypsin at 1:100 molar ratio

  • Analyze digestion patterns using SDS-PAGE

  • Conformational changes due to Mg²⁺ binding alter protease accessibility

4. Magnesium Uptake Measurements:

  • Use radioactive ²⁸Mg as a tracer

  • Employ a multi-compartment transport box to apply ²⁸Mg to specific regions

  • Measure uptake after defined time intervals (15 min, 1 h, 3 h)

  • Quantify transported Mg²⁺ using appropriate detection methods

5. Electrophysiological Methods:

  • Reconstitute purified MRS2-C in lipid bilayers or proteoliposomes

  • Measure ion currents using patch-clamp techniques

  • Determine channel properties including conductance, selectivity, and voltage dependence

How does the expression of MRS2-C vary across different tissues and developmental stages in rice?

RNA-seq data analysis reveals distinct expression patterns of MRS2-C and other MGT family members across rice tissues:

Tissue-Specific Expression Patterns:

Some CorA-like MGT genes, including those related to MRS2-C, demonstrate remarkable transcription rates across all rice tissues, while others show tissue-specific expression patterns. For example:

  • Some members show high expression in embryo tissues

  • Others are specifically expressed in anther tissues

  • Strong expression is generally observed in seed, inflorescence, anther, pistil, callus, and root tissues

This variation suggests that different MGT family members, including MRS2-C, play specific roles during various developmental stages in rice.

Expression During Development:

The expression patterns observed indicate that MGT genes are involved in multiple cellular functions throughout the rice life cycle, with particularly important roles in:

  • Seed development

  • Reproductive tissue formation

  • Root development

  • Embryogenesis

These patterns suggest that MRS2-C and related transporters are critical for proper magnesium distribution during key developmental processes in rice plants .

How do environmental stresses affect MRS2-C expression and function?

Environmental stresses significantly modulate the expression of MRS2-C and other MGT family members:

Response to Salt Stress:

Gene expression analysis using RT-qPCR found that four OsMGT genes exhibited different expression patterns in salt-sensitive and salt-tolerant rice genotypes, suggesting their involvement in salt stress responses .

Response to Multiple Stresses:

In comprehensive studies of the MGT family:

  • Approximately 39% of OsMGT genes showed induced expression under drought stress

  • Around 26% of OsMGT genes were induced under salinity stress

  • About 9% of OsMGT genes responded to cold stress

Aluminum Stress Response:

Under aluminum stress, specific MGT genes including OsMGT1 showed increased expression, which enhances magnesium absorption by roots and improves aluminum stress resistance .

Circadian Regulation:

Some MGT genes showed expression with a circadian rhythm pattern under magnesium toxicity conditions, particularly in leaf tissues .

The stress-responsive expression patterns suggest that MRS2-C and related transporters play important roles in maintaining magnesium homeostasis under adverse environmental conditions, contributing to stress tolerance mechanisms in rice.

What are the key structural features that determine MRS2-C specificity for magnesium transport?

Several structural features are critical for MRS2-C's magnesium transport specificity:

1. Conserved GMN Motif:

  • The GMN tripeptide near the C-terminal is a characteristic feature of CorA/MRS2/ALR-type transporters

  • This motif is essential for magnesium selectivity and transport function

  • Located in motif 4 as identified in sequence analyses

2. Critical Binding Residues:

  • The CorA-like clade-related proteins demonstrate the highest numbers of protein channels with Pro, Ser, Lys, Gly, and Tyr as the critical binding residues

  • These residues create a binding environment that favors Mg²⁺ over other divalent cations

3. Transmembrane Domains:

  • The α/β patterns in the protein structure are highly similar in CorA-like and NIPA members

  • Conserved structures in the Mg²⁺-binding and catalytic regions create a selective channel

  • The arrangement of these domains forms a pore with dimensions suitable for hydrated Mg²⁺ transport

4. Divalent Cation Binding Site:

  • The MRS2-C structure includes regions that can bind Mg²⁺ with most of its hydration shell

  • This feature permits selection against larger divalent cations like Ca²⁺

  • The expanded substrate binding site accommodates the hydrated Mg²⁺ ion

5. Conformational Changes:

  • MRS2 transporters exist in both open and closed conformations

  • Mg²⁺ binding can induce structural changes that regulate transport activity

  • These conformational states are important for controlled magnesium transport

How do oligomerization and protein-protein interactions influence MRS2-C function?

Oligomerization and protein-protein interactions are critical for MRS2-C function:

Oligomerization States:

MRS2 proteins can form:

  • Homodimers with themselves

  • Heterodimers with other MRS2 family members

  • Higher-order oligomeric structures

Studies using dynamic light scattering on related MRS2 proteins have shown:

  • Full-length MRS2 samples showed autocorrelation functions with size distributions centered at ~4 and ~20 nm

  • The presence of divalent cations like Co²⁺ can completely disrupt larger oligomeric formations

  • Mg²⁺ and Ca²⁺ affected N-terminal domain oligomerization but not full-length protein assembly

Regulatory Role of Protein-Protein Interactions:

  • Negative Feedback Mechanism:

    • Mg²⁺ binding to the human MRS2 protein channel amino terminal domain disrupts homomeric interactions

    • This serves as a negative feedback mechanism to inhibit mitochondrial Mg²⁺ uptake when levels are sufficient

  • Domain-Specific Sensitivity:

    • Different domains show specific sensitivity to divalent cations

    • N-terminal domain disassembly is promoted by Mg²⁺ and Ca²⁺

    • Full-length protein de-oligomerization is influenced by Co²⁺

  • Functional Implications:

    • Oligomerization state changes regulate channel opening and closing

    • Protein-protein interactions may facilitate cooperativity in transport

    • Interactions with other cellular proteins could integrate magnesium transport with other metabolic processes

These findings suggest that the functional activity of MRS2-C is likely regulated by its oligomerization state, which in turn is influenced by magnesium availability and possibly other cellular factors.

How can MRS2-C be utilized in genetic engineering approaches to improve magnesium use efficiency in crops?

MRS2-C can be leveraged in several genetic engineering strategies to enhance magnesium utilization in crops:

1. Overexpression Approaches:

  • Introducing additional copies of MRS2-C under constitutive or tissue-specific promoters

  • Enhancing expression in tissues with high magnesium demand

  • Engineering variants with improved transport efficiency

2. Promoter Modifications:
Studies have shown that sequence variations in the promoter regions of transporters can cause changes in transcript levels and mineral accumulation in grains . Similar approaches with MRS2-C could:

  • Increase basal expression levels

  • Modify responsiveness to environmental signals

  • Create stress-inducible expression patterns

3. Gene Editing Techniques:
CRISPR/Cas9 or similar technologies could be used to:

  • Fine-tune MRS2-C expression through targeted promoter modifications

  • Introduce specific mutations to enhance transport efficiency

  • Create variants with altered regulation to prevent negative feedback inhibition

4. Marker-Assisted Breeding:
MRS2-C variants could be incorporated into elite rice cultivars using marker-assisted backcrossing (MABC), similar to approaches used for other traits . This would:

  • Allow tracking of the transgene through breeding generations

  • Facilitate incorporation into multiple genetic backgrounds

  • Enable more rapid development of improved varieties

5. Pyramiding with Other Transporters:
Combining engineered MRS2-C with other transporter genes could:

How might manipulating MRS2-C expression impact other aspects of plant physiology and stress tolerance?

Manipulating MRS2-C expression could have multifaceted effects beyond magnesium homeostasis:

1. Stress Tolerance Enhancement:

Research has shown that magnesium can alleviate the toxicity of aluminum ions in plants . Modifying MRS2-C could:

  • Improve tolerance to aluminum stress by enhancing magnesium uptake

  • Increase resilience to salt stress through better ionic balance

  • Enhance drought tolerance via improved enzyme function and osmoregulation

2. Photosynthetic Efficiency:

Magnesium is central to chlorophyll structure and function. Optimized MRS2-C could:

  • Improve chlorophyll content and stability

  • Enhance photosynthetic efficiency

  • Increase carbon fixation and yield under limiting conditions

3. Nutritional Quality Improvements:

Engineered MRS2-C could contribute to biofortification efforts:

  • Increase magnesium content in edible tissues

  • Potentially influence the accumulation of other minerals

  • Research has shown that modifications to mineral transporters can affect multiple elements simultaneously

4. Cross-Talk with Other Minerals:

Magnesium interacts with other mineral nutrients. MRS2-C manipulation may:

  • Affect calcium homeostasis due to competition between Ca²⁺ and Mg²⁺

  • Influence uptake patterns of other divalent cations

  • Potentially reduce cadmium accumulation, as seen in cases where a major QTL for manganese accumulation showed decreased cadmium levels

5. Metabolic Implications:

Magnesium is a cofactor for numerous enzymes. Changed MRS2-C activity could:

  • Alter enzyme kinetics throughout primary metabolism

  • Affect ATP production and energy balance

  • Modify protein synthesis and growth patterns

What are the challenges in differentiating the roles of individual MGT family members in planta?

Researchers face several significant challenges when attempting to distinguish the specific roles of individual MGT family members like MRS2-C:

1. Functional Redundancy:

  • The MGT family in rice contains 23 non-redundant members

  • Multiple transporters may compensate for the loss of a single member

  • Overlapping expression patterns make it difficult to isolate individual roles

2. Technical Limitations:

  • Difficulties in creating clean knockout lines without affecting other genes

  • Challenges in measuring tissue-specific magnesium fluxes in vivo

  • Limited availability of magnesium-specific fluorescent probes for subcellular localization

3. Integration with Other Transport Systems:

  • Magnesium transport doesn't occur in isolation but interacts with other ion transport systems

  • Cross-talk between different mineral homeostasis pathways complicates interpretation

  • Effects on one mineral often cascade to others (as seen with manganese and cadmium)

4. Developmental and Environmental Variability:

  • Expression patterns change throughout development

  • Environmental conditions significantly alter transporter activity

  • Circadian and diurnal rhythms affect transporter expression

Recommended Approaches to Address These Challenges:

  • Multiplexed CRISPR/Cas9 for Systematic Knockouts:

    • Create single, double, and higher-order mutants to assess redundancy

    • Use tissue-specific promoters to drive Cas9 expression for localized studies

  • Cell-Type Specific Transcriptomics:

    • Employ techniques like INTACT (isolation of nuclei tagged in specific cell types)

    • Use laser capture microdissection to isolate specific tissues for expression analysis

  • Time-Resolved Imaging:

    • Develop better magnesium-specific fluorescent sensors

    • Use time-lapse imaging to track magnesium distribution during development and stress

  • Mathematical Modeling:

    • Develop integrative models of magnesium transport networks

    • Incorporate multiple transporters and their regulatory mechanisms

    • Use sensitivity analysis to identify key control points

What are the current unanswered questions regarding MRS2-C function and regulation?

Despite significant progress in understanding magnesium transporters, several critical questions about MRS2-C remain unanswered:

1. Regulatory Mechanisms:

  • How is MRS2-C transcriptionally regulated under different conditions?

  • What post-translational modifications affect MRS2-C activity?

  • How do feedback mechanisms sense and respond to cellular magnesium status?

2. Protein-Protein Interactions:

  • Does MRS2-C function independently or as part of larger protein complexes?

  • Are there accessory proteins that modulate its activity?

  • How do interactions with the cytoskeleton affect its localization and function?

3. Transport Kinetics:

  • What are the precise kinetic parameters of MRS2-C-mediated magnesium transport?

  • How do these parameters change under different conditions?

  • What is the energetic coupling mechanism for transport?

4. Subcellular Trafficking:

  • How is MRS2-C targeted to specific membranes?

  • What mechanisms control its turnover and degradation?

  • How does subcellular localization change in response to environmental cues?

5. Evolutionary History:

  • How has MRS2-C evolved compared to other MGT family members?

  • What selective pressures have shaped its function?

  • How do structural differences between species relate to functional adaptations?

6. Integration with Cellular Signaling:

  • Does MRS2-C participate in magnesium sensing and signaling?

  • How does it interact with hormonal and stress signaling pathways?

  • Could it function as both a transporter and a signaling component?

Research Approaches to Address These Questions:

  • Structural Studies:

    • Determine high-resolution structures in different conformational states

    • Map the binding sites of regulatory molecules and interacting proteins

    • Identify critical residues for various aspects of function

  • Systems Biology:

    • Integrate transcriptomic, proteomic, and metabolomic data

    • Develop network models of magnesium homeostasis

    • Identify key regulatory nodes affecting MRS2-C function

  • Real-Time Monitoring:

    • Develop biosensors to track magnesium flux in living cells

    • Use optogenetic approaches to manipulate MRS2-C activity with spatiotemporal precision

    • Correlate magnesium dynamics with physiological processes

  • Comparative Studies:

    • Compare MRS2-C function across different plant species

    • Relate functional differences to ecological adaptations

    • Identify conserved and divergent regulatory mechanisms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.