Recombinant Oryza sativa subsp. indica Magnesium transporter MRS2-F (MRS2-F)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Oryza sativa subsp. indica Magnesium transporter MRS2-F (MRS2-F) is a protein that functions as a magnesium transporter in Oryza sativa subsp. indica, commonly known as Indian rice . Magnesium transporters like MRS2-F are crucial for plant growth because they mediate magnesium uptake, which is essential for various cellular processes . Recombinant MRS2-F is produced using genetic engineering techniques, typically in E. coli, to facilitate research on its structure, function, and interactions .

Gene and Protein Information

FeatureDescription
Gene NameMRS2-F
SynonymsMRS2-F, OsI_04855, Magnesium transporter MRS2-F
SpeciesOryza sativa subsp. indica (Rice)
Protein LengthFull Length (1-444 amino acids)
UniProt IDA2WY50
UniProt NameMRS2F_ORYSI
Amino Acid SequenceMRPSAAAGGGGGGGGRRKAAAAAAAASREWLVVPASGQARVEEAGKHAVMARTGLPARDL RVLDPLLSYPSTILGRERAIVVNLERVKAVITAAEVLLPNSKDPAFASFVCDLQARVLAS SSDQAAEFTDMEGESSAVTSPFPALTSTTPNELEMTNKNSNVVGGMTHSNSMPTLTAAKD GNTKVLPFEFRALEVCLESACRSLEEETSTLEQEAYPALDELTSKISTLNLERVRQIKSR LVAISGRVQKVRDELEHLLDDEMDMAEMYLTEKLTRQEISETSSRVEVDDPSQLEVDRDE DYRSEADVSNGTFIGYKPHIEELEMLLEAYFVQIDGTLNKLSHLREYVDDTEDYINIMLD DKQNQLLQMGVMLSTATVVITAGVAVVGLFGMNIGISLYADPTNEEEKRASNMKFWETTL GTIAGCTVMYIVAMGWGKRSGLLQ
Molecular Weight48,356 Da

Production and Characteristics

  • Recombinant Production: MRS2-F is produced in hosts like E. coli to obtain the protein for research purposes . The protein is often fused with an N-terminal His tag to facilitate purification using affinity chromatography .

  • Purity: Recombinant MRS2-F typically has a purity of ≥85% as determined by SDS-PAGE . Some products claim purity greater than 90% .

  • Form: It is generally available as a lyophilized powder .

  • Storage: The protein should be stored at -20°C or -80°C upon receipt. Repeated freezing and thawing is not recommended, and working aliquots should be stored at 4°C for up to one week .

  • Storage Buffer: Tris/PBS-based buffer with 6% Trehalose at pH 8.0 is commonly used . Some products use a Tris-based buffer with 50% glycerol .

  • Reconstitution: The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% glycerol (final concentration) and aliquoting is recommended for long-term storage .

Function and Subcellular Localization

  • Function: MRS2-F functions as a magnesium transporter that may mediate the influx of magnesium . Magnesium is vital for many plant physiological processes.

  • Subcellular Localization: The protein is located in the membrane and is a multi-pass membrane protein .

Related Products and Applications

Recombinant MRS2-F is used in various research applications including:

  • Protein-protein interaction studies: Identifying proteins that interact with MRS2-F to understand its role in magnesium transport and related pathways .

  • Antibody production: Recombinant MRS2-F can be used to generate specific antibodies for detection and localization studies .

  • Biochemical assays: Studying the magnesium transport activity of MRS2-F and its regulation .

Pathways and Interactions

  • Involved Pathways: MRS2-F participates in several pathways and plays different roles .

  • Interacting Proteins: MRS2-F interacts directly with other proteins and molecules, as detected by methods such as yeast two-hybrid assays and co-immunoprecipitation .

Precautions

  • Repeated freezing and thawing should be avoided .

  • For research use only, not for clinical use .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MRS2-F; OsI_04855; Magnesium transporter MRS2-F
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-444
Protein Length
full length protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
MRS2-F
Target Protein Sequence
MRPSAAAGGGGGGGGRRKAAAAAAAASREWLVVPASGQARVEEAGKHAVMARTGLPARDL RVLDPLLSYPSTILGRERAIVVNLERVKAVITAAEVLLPNSKDPAFASFVCDLQARVLAS SSDQAAEFTDMEGESSAVTSPFPALTSTTPNELEMTNKNSNVVGGMTHSNSMPTLTAAKD GNTKVLPFEFRALEVCLESACRSLEEETSTLEQEAYPALDELTSKISTLNLERVRQIKSR LVAISGRVQKVRDELEHLLDDEMDMAEMYLTEKLTRQEISETSSRVEVDDPSQLEVDRDE DYRSEADVSNGTFIGYKPHIEELEMLLEAYFVQIDGTLNKLSHLREYVDDTEDYINIMLD DKQNQLLQMGVMLSTATVVITAGVAVVGLFGMNIGISLYADPTNEEEKRASNMKFWETTL GTIAGCTVMYIVAMGWGKRSGLLQ
Uniprot No.

Target Background

Function
A magnesium transporter potentially mediating magnesium influx.
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35.5) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What structural features define MRS2-F and other CorA/MRS2/ALR-type transporters?

MRS2-F belongs to the CorA/MRS2/ALR-type magnesium transporter family characterized by a highly conserved F/Y-G-M-N motif that is crucial for magnesium transport activity. This motif plays a direct role in channel function, as demonstrated by mutation studies showing that exchanging the glycine residue to alanine results in significantly reduced magnesium influx in mitochondria . MRS2 proteins typically contain two transmembrane domains with the N-terminal regions facing the cytosol or organelle matrix. The functional transporter exists as a homopentamer forming a selective ion channel across the membrane.

What is the subcellular localization pattern of MRS2 transporters in rice compared to other plant species?

MRS2 family transporters in plants exhibit diverse subcellular localizations. The founding member, Mrs2p, was identified as the first molecularly characterized metal ion channel protein in the inner mitochondrial membrane . In comparative studies across plant species, different MRS2 family members target specific cellular compartments: some localize to mitochondria (like PbrMGT7 in pear, which maintains mitochondrial Mg²⁺ homeostasis), while others target the plasma membrane, vacuole (AtMRS2-1), or other cellular compartments . In rice specifically, different family members likely have specialized subcellular targeting, though complete localization data for all rice MRS2 transporters is not fully characterized in the literature.

How are MRS2 genes organized phylogenetically across plant species?

Phylogenetic analysis of MRS2 transporters reveals they are organized into five distinct evolutionary clusters. According to research on tomato MRS2 transporters (which provides insights applicable to rice), a total of 39 MRS2 proteins from four species (tomato, Arabidopsis, maize, and rice) distribute across these five clusters. For example, "SlMRS2-3 was presented in cluster IV and the SlMRS2-1, 2-5 belonged to cluster V. SlMRS2-2 and 2-1 were in cluster II, and SlMRS2-4 was a member of cluster III. Only SlMRS2-11 belonged to cluster I" . Most MRS2 transporters in tomato showed higher sequence similarity to Arabidopsis homologs than to those from monocot species like maize and rice. This suggests evolutionary conservation of function across dicots, with potential functional divergence in monocots.

What are the optimal protocols for heterologous expression and functional validation of rice MRS2 transporters?

The gold standard for functional validation of MRS2 transporters involves complementation assays in the yeast Mg²⁺ transport-defective mutant CM66, which lacks plasma membrane Mg²⁺ transporters ALR1 and ALR2 . The recommended protocol includes:

  • Amplify the open reading frame of the MRS2 gene from full-length cDNA

  • Clone into a yeast expression vector (e.g., pYES2) with correct orientation

  • Transform into CM66 yeast cells using standard transformation protocols

  • Select transformants on synthetic dextrose medium without uracil (SD-U)

  • Culture positive clones in SD-U liquid medium until early logarithmic phase

  • Wash cells three times with sterile distilled water

  • Spot 10-fold serial dilutions on SD-U plates containing varying MgCl₂ concentrations (e.g., 1, 4, 64 mmol/L)

  • Incubate at 30°C for 3 days before evaluating growth phenotypes

  • Additionally, quantify growth in liquid SD-U media containing different Mg²⁺ concentrations by measuring OD₆₀₀ over time

Successful complementation, indicated by restored growth under low Mg²⁺ conditions, confirms the Mg²⁺ transport functionality of the candidate gene.

What experimental designs are most effective for studying MRS2 expression under varying magnesium conditions?

For investigating MRS2 expression responses to varying magnesium conditions, a hydroponic culture system with precise nutrient control is most effective. Based on experimental protocols described in the literature, the following design is recommended:

  • Surface-sterilize rice seeds with 10% hydrogen peroxide for 30 minutes

  • Germinate seeds for 48 hours under dark conditions at 30°C

  • Establish an augmented randomized complete block design with at least three replicates

  • Grow seedlings in modified IRRI nutrient solution (comprising 1.0 mM MgSO₄·7H₂O, 1.25 mM NH₄NO₃, 0.3 mM KH₂PO₄, 1.0 mM CaCl₂, 0.35 mM K₂SO₄, and micronutrients)

  • Initially grow seedlings in 1/4 strength solution for two weeks

  • Transfer to full-strength solutions with contrasting Mg²⁺ concentrations (e.g., 0 mM for deficiency, 1.0 mM for control, >1.0 mM for excess)

  • Maintain growth under controlled conditions (14h light at 30°C/10h dark at 22°C, 60% relative humidity)

  • Replace nutrient solution every three days and adjust pH to 5.5 daily

  • Harvest tissues separately (roots, shoots, leaves) after three weeks of treatment

  • Extract RNA using Trizol reagent and perform qRT-PCR analysis

This experimental design allows for precise measurement of gene expression changes in response to magnesium availability while minimizing confounding variables.

How can advanced imaging techniques be applied to study MRS2 localization and transport activity?

While the search results don't explicitly detail imaging methodologies for MRS2 transporters, the following approaches would be appropriate based on current research practices:

  • Subcellular localization:

    • Generate GFP/YFP fusion constructs of MRS2-F

    • Express in rice protoplasts or stable transgenic lines

    • Visualize using confocal microscopy with appropriate organelle markers

    • Perform co-localization analysis with mitochondrial, plasma membrane, or other compartment markers

  • Transport activity visualization:

    • Utilize Mg²⁺-specific fluorescent dyes (e.g., Mag-Fura-2, KMG-104)

    • Perform time-lapse imaging to track Mg²⁺ flux in response to changing conditions

    • Combine with electrophysiological techniques for direct measurement of transport activity

  • Protein dynamics:

    • Apply fluorescence recovery after photobleaching (FRAP) to measure protein mobility

    • Use Förster resonance energy transfer (FRET) to detect protein-protein interactions

    • Employ super-resolution microscopy for detailed structural analysis

These techniques would provide valuable insights into the localization, dynamics, and functional properties of MRS2-F in rice cells.

What QTLs have been identified for magnesium uptake and translocation in rice?

Multiple quantitative trait loci (QTLs) governing magnesium homeostasis in rice have been identified through association analysis using a multi-parent advanced generation inter-cross (MAGIC) population. Specifically:

  • Root Mg²⁺ concentration: Four QTLs (qRMg1, qRMg2, qRMg7, and qRMg8) explaining 11.45-13.08% of phenotypic variation

  • Shoot Mg²⁺ concentration: Three QTLs (qSMg3, qSMg7, and qSMg10) explaining 4.30-5.46% of phenotypic variation

  • Mg²⁺ translocation from roots to shoots: Two QTLs (qTrMg3 and qTrMg8) explaining 10.91% and 9.63% of phenotypic variation

Notably, qSMg3 and qTrMg3 are positioned in close proximity on chromosome 3, suggesting they may represent the same genetic locus affecting both shoot Mg²⁺ accumulation and root-to-shoot translocation . These QTLs provide valuable genetic targets for improving magnesium efficiency in rice breeding programs.

How do genetic variations in MRS2 genes affect magnesium uptake efficiency across rice varieties?

Genetic variation in MRS2 transporters appears to significantly impact magnesium uptake efficiency in rice. Research has identified that specific candidate genes within QTL regions, such as OsMGT1 within qRMg1 and LOC_Os03g04360 within qSMg3/qTrMg3, play crucial roles in Mg²⁺ transport . Complementation studies in yeast mutants and sequence analysis of parental lines with contrasting Mg²⁺ uptake traits have confirmed functional relevance of these genetic variations.

Specifically, overexpression of LOC_Os03g04360 (a candidate gene within qSMg3/qTrMg3) "can significantly increase the Mg²⁺ concentration in rice seedlings, especially under the condition of low Mg²⁺ supply" . This suggests that allelic variations in this and other MRS2 family genes directly contribute to differences in Mg²⁺ acquisition efficiency among rice varieties, with particular importance under magnesium-limited conditions.

What experimental approaches are most effective for gene validation studies of candidate magnesium transporters?

Multiple complementary approaches are necessary for robust validation of candidate magnesium transporter genes. Based on successful studies, the following integrated workflow is recommended:

  • Expression analysis:

    • Quantify expression patterns across tissues and developmental stages

    • Examine expression responses to magnesium deficiency using qRT-PCR

    • Compare expression profiles between varieties with contrasting Mg²⁺ efficiency

  • Functional complementation:

    • Express the candidate gene in yeast mutant CM66 lacking ALR1 and ALR2 transporters

    • Test growth rescue under varying Mg²⁺ concentrations (1-128 mmol/L)

    • Quantify growth rates in liquid culture by measuring OD₆₀₀

  • Sequence analysis:

    • Compare coding sequences between varieties with contrasting Mg²⁺ uptake

    • Identify polymorphisms that correlate with phenotypic differences

    • Predict functional impacts of identified polymorphisms

  • Transgenic validation:

    • Generate overexpression and knockout/knockdown lines

    • Evaluate phenotypes under varying Mg²⁺ conditions

    • Measure Mg²⁺ concentrations in different tissues

This multi-faceted approach has successfully validated LOC_Os03g04360 as an important regulator of Mg²⁺ uptake and translocation in rice .

How do MRS2 genes respond to varying magnesium conditions at the transcriptional level?

MRS2 family genes exhibit complex transcriptional responses to varying magnesium conditions. Based on studies in tomato (which provide insights applicable to rice MRS2 transporters), these responses show tissue-specific patterns:

  • Under magnesium limitation:

    • Expression is typically down-regulated in leaves

    • Greater impact observed in lower and middle leaves compared to young leaves

    • This suggests prioritization of magnesium allocation to developing tissues

  • Under magnesium toxicity:

    • Several MRS2 genes are up-regulated in leaves

    • Expression patterns follow a circadian rhythm

    • This indicates potential roles in excess magnesium detoxification

  • In roots:

    • Most MRS2 genes show an initial increase followed by decrease in expression under varying Mg²⁺ conditions

    • This biphasic response suggests complex regulatory mechanisms

These differential expression patterns across tissues and conditions reflect sophisticated transcriptional control mechanisms that coordinate magnesium homeostasis throughout the plant.

What are the tissue-specific expression patterns of MRS2 transporters in rice?

While specific information about MRS2-F expression in rice is limited in the search results, studies of MRS2 family genes in other plants provide valuable insights into likely expression patterns. In tomato, MRS2 transporters show distinct tissue-specific expression profiles:

  • Some members (e.g., SlMRS2-11) are primarily expressed in mature leaves

  • Others (e.g., SlMRS2-1) show highest expression in roots

  • Some exhibit very restricted expression patterns, such as SlMRS2-I being "only expressed in the fully expanded leaf"

  • Many are expressed across multiple tissues, suggesting functional redundancy

Based on these patterns, rice MRS2 transporters likely exhibit similar tissue specialization, with some members predominantly expressed in roots for uptake from soil, others in vascular tissues for translocation, and still others in photosynthetic tissues where magnesium plays crucial roles in chlorophyll and enzyme function.

How do MRS2 transporters interact with aluminum stress responses in rice?

MRS2 transporters play significant roles in aluminum stress responses, a particularly important adaptation for rice cultivated in acidic soils where aluminum toxicity is prevalent. Research indicates complex interactions between magnesium transport and aluminum tolerance:

  • Certain MRS2 transporters directly contribute to aluminum tolerance:

    • In rice, "OsMGT1 improved Al tolerance by enhancing the concentration of Mg²⁺ in rice cells"

    • This suggests that maintaining adequate cellular Mg²⁺ levels can mitigate aluminum toxicity

  • Different MRS2 family members show varying responses to aluminum stress:

    • Some transporters (comparable to AtMRS2-10 and AtMRS2-11 in Arabidopsis) exhibit high sensitivity to aluminum toxicity

    • Others (similar to AtMRS2-1) show no sensitivity to aluminum stress

  • The protective mechanism likely involves:

    • Competition between Mg²⁺ and Al³⁺ for binding sites

    • Maintenance of membrane integrity and enzyme function through adequate Mg²⁺ supply

    • Potentially specialized regulatory pathways that activate specific MRS2 transporters under aluminum stress

These interactions highlight the importance of MRS2 transporters beyond basic nutritional roles, extending to abiotic stress tolerance mechanisms.

What strategies can enhance MRS2-mediated magnesium use efficiency in rice breeding programs?

Several strategies can be implemented to improve magnesium use efficiency in rice through MRS2 transporter optimization:

  • Marker-assisted selection:

    • Develop molecular markers for favorable alleles within the identified QTLs (qRMg1, qSMg3, etc.)

    • Screen germplasm for optimal allelic combinations across multiple MRS2 loci

    • Integrate these markers into existing breeding programs

  • Genetic engineering approaches:

    • Overexpress key MRS2 transporters (e.g., LOC_Os03g04360) to enhance Mg²⁺ uptake capacity

    • Modify expression patterns to improve Mg²⁺ allocation to harvested tissues

    • Fine-tune regulatory elements for optimal expression under varying Mg²⁺ conditions

  • CRISPR/Cas9 genome editing:

    • Target specific functional domains to enhance transport activity

    • Modify regulatory regions to alter expression patterns

    • Generate precise allelic variants based on naturally occurring high-efficiency alleles

  • Pyramiding complementary traits:

    • Combine enhanced Mg²⁺ uptake with improved root architecture

    • Integrate with other nutrient efficiency traits for comprehensive nutrient management

The successful application of these strategies could significantly improve rice productivity in magnesium-limited soils, where deficiencies "could lead to a 40–60% yield reduction" .

How do MRS2 transporters coordinate with other ion transport systems in maintaining cellular homeostasis?

MRS2 transporters function within a complex network of ion transport systems to maintain cellular homeostasis. While the search results don't provide exhaustive details on these interactions, several important coordination mechanisms can be inferred:

What methodological approaches can best assess the impact of MRS2-F modifications on whole-plant physiology?

To comprehensively evaluate the effects of MRS2-F modifications on whole-plant physiology, a multi-level phenotyping approach is recommended:

This comprehensive phenotyping pipeline would provide a detailed understanding of how MRS2-F modifications affect rice physiology from molecular mechanisms to agronomic performance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.