Recombinant Oryza sativa subsp. indica MLO protein homolog 1 (MLO1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
MLO1; MLO-H1; OsI_022215; MLO protein homolog 1; OsMLO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-540
Protein Length
full length protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
MLO1
Target Protein Sequence
MAGGRSGSRELPETPTWAVAVVCAVLVLVSAAMEHGLHNLSHWFRRRQKKAMGDALDKIK AELMLLGFISLLLTVAQAPISKICIPKSAANILLPCKAGQDAIEEEAASGRRSLAGAGGG DYCSKFDGKVALMSAKSMHQLHIFIFVLAVFHVTYCIITMGLGRLKMKKWKKWESQTNSL EYQFAIDPSRFRFTHQTSFVKRHLGSFSSTPGLRWIVAFFRQFFGSVTKVDYLTMRQGFI NAHLSQNSKFDFHKYIKRSLEDDFKVVVGISLPLWFVGILVLFLDIHGLGTLIWISFVPL IIVLLVGTKLEMVIMEMAQEIQDRATVIQGAPMVEPSNKYFWFNRPDWVLFFIHLTLFHN AFQMAHFVWTMATPGLKKCFHENIWLSIVEVIVGISLQVLCSYITFPLYALVTQMGSNMK KTIFEEQTMKALMNWRKKAMEKKKVRDADAFLAQMSVDFATPASSRSASPVHLLQDHRAR SDDPPSPITVASPPAPEEDMYPVPAAAASRQLLDDPPDRRWMASSSADIADSDFSFSAQR
Uniprot No.

Target Background

Function
This protein may play a role in modulating pathogen defense and leaf cell death. Its activity appears to be regulated by Ca(2+)-dependent calmodulin binding and does not seem to require heterotrimeric G proteins.
Protein Families
MLO family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is MLO1 protein and what is its role in rice plants?

MLO1 (Mildew Locus O protein homolog 1) is a plant-specific transmembrane protein that belongs to the MLO gene family in rice. The full-length protein consists of 540 amino acids with a molecular mass of approximately 62 kDa . MLO1 is part of a unique protein family initially identified for its role in plant-pathogen interactions, particularly as a susceptibility factor to powdery mildew pathogens . In rice, MLO1 functions as a modulator of plant defense responses and cell death mechanisms . The protein contains seven transmembrane domains and exhibits characteristic MLO functional domains that are well-conserved across plant species . MLO1 is known to interact with calmodulin in a calcium-dependent manner through a specific 20-amino acid calmodulin-binding domain (CaMBD) located in its C-terminal cytoplasmic tail, suggesting its involvement in calcium signaling pathways related to plant defense responses .

How is the expression pattern of MLO1 regulated in rice plants?

MLO1 expression in rice demonstrates tissue specificity and is notably responsive to environmental cues. Studies have shown that OsMLO1 exhibits diurnal expression patterns, indicating its potential significance in responses to environmental changes . This diurnal rhythm suggests MLO1 may play roles beyond pathogen defense, potentially involving light-responsive pathways. Specifically, research has identified connections between MLO1 expression and the methylerythritol 4-phosphate pathway, which is involved in light responses .

Expression analyses reveal that MLO1 is strongly induced following fungal pathogen infection and exposure to plant defense signaling molecules . In particular, when rice plants are infected with pathogens like Magnaporthe oryzae (rice blast), significant changes in MLO gene expression are observed, although OsMLO3 shows more pronounced upregulation than OsMLO1 in this context . These expression patterns suggest sophisticated regulatory mechanisms that fine-tune MLO1 activity according to specific developmental, physiological, and stress conditions.

What are the recommended storage and handling protocols for recombinant MLO1 protein?

Proper handling of recombinant MLO1 protein is critical for maintaining its structural integrity and biological activity. Based on established protocols, the following handling procedures are recommended:

  • Storage conditions: Store recombinant MLO1 protein at -20°C/-80°C upon receipt . For long-term storage, maintaining -80°C is preferable to minimize protein degradation.

  • Aliquoting: Divide the protein into small working aliquots immediately after receipt to avoid repeated freeze-thaw cycles, which can significantly compromise protein integrity .

  • Short-term storage: Working aliquots can be stored at 4°C for up to one week, but not longer, as protein stability decreases over time at this temperature .

  • Reconstitution protocol:

    • Briefly centrifuge the vial before opening to bring contents to the bottom

    • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (typically 50% is recommended) for storage

    • Aliquot immediately after reconstitution

  • Buffer conditions: The protein is typically stored in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which helps maintain protein stability .

This careful handling is essential because membrane proteins like MLO1 are particularly susceptible to denaturation during freeze-thaw cycles and improper storage conditions.

How does the calmodulin-binding functionality of OsMLO1 influence its role in defense signaling?

The calmodulin (CaM)-binding capability of OsMLO1 represents a critical functional aspect that directly connects this protein to calcium-mediated defense signaling in rice. Experimental evidence demonstrates that OsMLO1 binds to calmodulin in a strictly Ca²⁺-dependent manner through a specific 20-amino acid calmodulin-binding domain (CaMBD) located in its C-terminal cytoplasmic region . This interaction is likely central to how MLO1 modulates defense responses.

The mechanistic significance of this binding appears to involve several interconnected signaling pathways:

  • Calcium signal transduction: Transient Ca²⁺ influx constitutes an early event in defense signaling cascades. The binding of Ca²⁺-loaded CaM to MLO1 likely represents a downstream component of these pathways, translating calcium signatures into specific cellular responses .

  • Regulatory function: Based on research with barley MLO (which shares 65% sequence identity with OsMLO1), the CaM-binding capability may enable MLO1 to function as a negative regulator of disease resistance and programmed cell death . This negative regulation could maintain cellular homeostasis under normal conditions while allowing for rapid defense responses when pathogens are detected.

  • Conformational changes: The binding of Ca²⁺-CaM to the C-terminal tail may induce conformational changes in the MLO1 protein structure, potentially affecting its interaction with other signaling components or its activity as a transmembrane channel.

Methodological approaches to study this interaction include:

  • Gel overlay assays with recombinant OsMLO1 and CaM proteins

  • Site-directed mutagenesis of the CaMBD to validate specific binding sites

  • Gel mobility shift assays to confirm complex formation

  • Competition assays with Ca²⁺/CaM-dependent enzymes

Understanding this interaction is particularly valuable for developing strategies to modulate plant immunity, as the CaMBD represents a potential target for genetic engineering approaches aimed at enhancing disease resistance.

What experimental approaches can determine if MLO1 functions as a susceptibility factor to rice powdery mildew?

Based on knowledge from other plant species, MLO proteins belonging to specific phylogenetic clades function as susceptibility factors to powdery mildew. Determining whether rice MLO1 specifically serves this function requires systematic experimental approaches:

  • Phylogenetic analysis: Comprehensive phylogenetic analysis reveals that MLO proteins distribute among seven distinct clades (I-VII) . In monocots like rice, clade IV MLOs typically function as powdery mildew susceptibility factors, while in dicots, this function is associated with clade V MLOs . Analyzing where OsMLO1 fits in this phylogeny provides initial evidence of its potential role.

  • Expression analysis during infection: Quantitative RT-PCR analysis following controlled powdery mildew infection can determine if OsMLO1 is significantly upregulated, similar to what has been observed with known susceptibility-related MLOs in other species. Studies in cannabis, for example, showed that clade V MLOs were significantly upregulated following Golovinomyces ambrosiae infection .

  • Gene silencing/knockout approaches:

    • RNAi-mediated silencing of MLO1

    • CRISPR-Cas9 gene editing to create loss-of-function mutations

    • TILLING (Targeting Induced Local Lesions IN Genomes) to identify natural or induced mutations

  • Transgenic complementation: Introducing MLO1 into resistant lines with non-functional MLO alleles to see if susceptibility is restored.

  • Comparative inoculation assays: Comparing powdery mildew disease progression between:

    • Wild-type plants

    • MLO1 knockdown/knockout lines

    • MLO1-overexpressing lines

Experimental ApproachTechnical RequirementsExpected Outcome if MLO1 is a Susceptibility FactorLimitations
CRISPR-Cas9 knockoutRice transformation capability, powdery mildew inoculation systemReduced infection in knockout lines compared to wild-typePotential off-target effects, functional redundancy with other MLOs
RNAi silencingVector construction, efficient transformationDecreased susceptibility correlating with silencing levelIncomplete silencing, off-target effects
Transcriptional analysis during infectionRNA extraction protocols, qRT-PCRSignificant upregulation post-infectionCorrelation only, not causation
Virus-induced gene silencingAppropriate viral vectors for riceLocalized resistance in silenced tissueLimited to tissues accessible to viral vectors
Overexpression studiesConstitutive promoters, transformationIncreased susceptibility to powdery mildewPotential developmental abnormalities

These experiments should be conducted with appropriate controls and replicated across different rice cultivars to account for genetic background effects.

How can researchers optimize heterologous expression of functional OsMLO1 protein?

Expressing membrane proteins like OsMLO1 presents significant challenges due to their hydrophobic transmembrane domains and complex folding requirements. Here is a methodological framework for optimizing heterologous expression:

  • Expression system selection: While E. coli is commonly used (as seen with the commercially available recombinant OsMLO1 ), alternative expression systems may yield better results for functional studies:

    • Yeast systems (Pichia pastoris or Saccharomyces cerevisiae): Provide eukaryotic processing machinery

    • Insect cell systems (Sf9, High Five): Better suited for complex eukaryotic membrane proteins

    • Plant-based expression systems: May provide plant-specific post-translational modifications

  • Construct optimization:

    • Codon optimization for the selected expression host

    • Inclusion of appropriate fusion tags (His-tag is standard , but others like MBP or GST may improve solubility)

    • Consideration of truncated constructs that retain functional domains (especially the CaMBD region) but remove problematic transmembrane segments

    • Careful design of linker regions between the protein and tags

  • Expression conditions optimization:

    • Temperature modulation (typically lower temperatures for membrane proteins)

    • Induction parameters (inducer concentration, timing, duration)

    • Media composition (potential addition of membrane-stabilizing agents)

    • Growth phase at induction (mid-log phase typically optimal)

  • Purification strategy refinement:

    • Selection of appropriate detergents for membrane protein extraction

    • Optimization of detergent concentration and buffer composition

    • Implementation of multi-step purification incorporating affinity chromatography, size exclusion, and ion exchange techniques

    • Consideration of lipid nanodiscs or amphipols for maintaining native-like membrane environment

  • Functionality verification assays:

    • Calmodulin binding assays (gel overlay, surface plasmon resonance)

    • Structural assessment via circular dichroism or limited proteolysis

    • Size exclusion chromatography to verify proper folding/oligomerization state

The success of recombinant MLO1 expression should be measured not only by protein yield but also by retention of biological activity, particularly its ability to bind calmodulin in a Ca²⁺-dependent manner .

What genetic variations exist in MLO1 across rice varieties and how might they impact function?

Genetic variation in MLO1 across rice varieties represents an important area of investigation, as natural polymorphisms can provide insights into functional domains and potential targets for breeding resistance. While specific data on OsMLO1 variation across rice varieties is limited in the provided search results, a methodological approach to this question can be outlined based on similar studies in other species:

  • Comparative sequence analysis:

    • Sequencing MLO1 across diverse rice germplasm, including wild relatives, landraces, and elite cultivars

    • Focusing on both coding regions (for amino acid changes) and regulatory regions (for expression differences)

    • Analyzing SNPs, insertions/deletions, and copy number variations

  • Structure-function correlation:

    • Mapping identified variations onto predicted protein domains, particularly the seven transmembrane regions and the calmodulin-binding domain

    • Special attention to variations in conserved regions that may affect protein function

  • Association with phenotypic resistance:

    • Phenotyping diverse rice accessions for powdery mildew resistance

    • Conducting association studies to link MLO1 variants with resistance/susceptibility phenotypes

In comparable studies with cannabis MLO genes, researchers found several amino acid changes in clade V MLOs across 32 cannabis cultivars, which could potentially affect their function as susceptibility factors . Similar variation likely exists in rice MLO1, especially given the extensive genetic diversity in cultivated rice and its wild relatives.

Variations of particular interest would include:

  • Mutations affecting the calmodulin-binding domain

  • Changes in transmembrane domains that could affect protein topology

  • Alterations to conserved amino acid positions known to be essential for MLO function

  • Promoter variations potentially affecting expression patterns or levels

What approaches can be used to study MLO1 protein-protein interactions in planta?

Understanding the protein interaction network of MLO1 is crucial for elucidating its functional mechanisms in defense signaling. Several complementary methods can be employed to study these interactions in planta:

  • Co-immunoprecipitation (Co-IP):

    • Generate antibodies specific to OsMLO1 or use epitope-tagged versions

    • Extract total protein under native conditions that preserve interactions

    • Immunoprecipitate MLO1 complexes and identify interacting partners via mass spectrometry

    • This approach has successfully identified calmodulin as an MLO1 binding partner

  • Bimolecular Fluorescence Complementation (BiFC):

    • Create fusion constructs linking MLO1 and candidate interactors to split fluorescent protein fragments

    • Co-express in rice protoplasts or via transient expression in rice leaves

    • Visualize reconstituted fluorescence when proteins interact

    • This technique provides spatial information about where interactions occur within the cell

  • Förster Resonance Energy Transfer (FRET):

    • Generate donor and acceptor fluorophore fusions with MLO1 and potential interactors

    • Measure energy transfer between fluorophores when proteins are in close proximity

    • Especially useful for studying dynamic interactions in living cells

  • Yeast two-hybrid membrane systems:

    • Use specialized membrane yeast two-hybrid systems designed for transmembrane proteins

    • Screen cDNA libraries to identify novel interactors

    • Validate interactions with techniques like GST pull-down assays

  • Proximity-dependent biotin identification (BioID):

    • Fuse MLO1 to a promiscuous biotin ligase

    • Express in rice cells where the ligase will biotinylate proteins in close proximity to MLO1

    • Purify biotinylated proteins and identify by mass spectrometry

    • Particularly useful for identifying transient or weak interactions

  • Cross-linking mass spectrometry:

    • Chemically cross-link proteins in their native state

    • Digest and analyze by mass spectrometry to identify interaction interfaces

    • Provides structural information about the interaction

The combination of these approaches can provide a comprehensive view of MLO1's interaction network, helping to elucidate its role in calcium signaling and defense response pathways.

How can transcriptome analysis help understand the broader impact of MLO1 in rice immunity?

Transcriptomic approaches offer powerful tools to understand the regulatory networks and signaling pathways influenced by MLO1. Here's a methodological framework for using transcriptome analysis to investigate MLO1's role in rice immunity:

  • Experimental design strategies:

    • Differential expression analysis: Compare wild-type plants with MLO1 knockout/knockdown lines under both basal and pathogen-challenged conditions

    • Time-course experiments: Analyze expression changes over time following pathogen infection in both wild-type and MLO1-modified plants

    • Tissue-specific analysis: Compare transcriptional changes in different tissues, reflecting the tissue-specific expression patterns observed for MLO genes

    • Co-expression network analysis: Identify genes with expression patterns that correlate with MLO1 to discover functional associations

  • Key methodological considerations:

    • Use biological replicates (minimum n=3) for statistical robustness

    • Include appropriate controls for developmental stage and environmental conditions

    • Consider the timing of sampling based on known infection dynamics

    • Validate key findings with qRT-PCR or protein-level analyses

  • Data analysis approaches:

    • Gene Ontology (GO) enrichment analysis to identify biological processes affected by MLO1 alteration

    • Pathway analysis focusing on defense signaling, calcium signaling, and hormone pathways

    • Comparison with publicly available datasets of plants responding to various pathogens and stresses

    • Identification of transcription factor binding sites in co-regulated genes

  • Integration with other data types:

    • Correlate transcriptomic changes with metabolomic data, particularly defense-related compounds

    • Combine with ChIP-seq data to identify direct transcriptional regulation events

    • Integrate with proteomics data to account for post-transcriptional regulation

This approach can reveal whether MLO1 functions primarily in a specific defense pathway or has broader effects on multiple aspects of plant immunity. For instance, research with rice MLO genes has already shown connections between MLO expression and responses to various stresses, including heat, cold, and pathogen infection , suggesting complex regulatory networks that could be further elucidated through comprehensive transcriptome analysis.

What are promising strategies for engineering durable powdery mildew resistance through MLO1 modification?

Based on the understanding that MLO proteins can function as susceptibility factors for powdery mildew pathogens, several strategic approaches show promise for engineering durable resistance through MLO1 modification:

  • Genome editing approaches:

    • CRISPR-Cas9-mediated knockout of MLO1, potentially targeting multiple MLO genes simultaneously to overcome functional redundancy

    • Base editing or prime editing to introduce specific mutations known to disrupt MLO function without completely removing the gene

    • Precision editing of regulatory elements to modulate expression patterns rather than eliminating the protein entirely

  • Targeted mutation strategies:

    • Introduction of mutations specifically in the calmodulin-binding domain to disrupt calcium signaling while preserving other functions

    • Modification of transmembrane domains to alter protein topology

    • Engineering of chimeric MLO proteins that maintain growth functions but lack susceptibility functions

  • Expression modulation approaches:

    • Development of pathogen-responsive promoters that downregulate MLO1 only during infection

    • Use of tissue-specific promoters to maintain MLO1 function in tissues where it may be essential while eliminating it in tissues susceptible to powdery mildew

    • RNA interference or artificial microRNA strategies for conditional silencing

  • Combinatorial strategies:

    • Pyramiding modified MLO alleles with other resistance genes for more durable protection

    • Combining MLO modification with enhancement of defense response pathways

The effectiveness of these approaches would need to be evaluated not only for disease resistance but also for potential pleiotropic effects on plant growth, development, and responses to other stresses, as MLO genes are known to have diverse functions beyond pathogen susceptibility . Additionally, because rice has 12 MLO family members with potentially overlapping functions , comprehensive analysis of the entire family would be necessary to develop optimal engineering strategies.

How might the diurnal expression pattern of MLO1 connect to broader environmental response networks?

The discovery that OsMLO1 exhibits diurnal expression patterns opens intriguing questions about its integration into environmental response networks beyond pathogen defense. A comprehensive research approach to explore these connections would include:

  • Circadian regulation analysis:

    • Detailed time-course expression studies under constant conditions to distinguish true circadian regulation from light-responsive expression

    • Analysis of MLO1 promoter regions for circadian clock-associated motifs

    • Evaluation of MLO1 expression in circadian clock mutant backgrounds

  • Light signaling pathway investigation:

    • Expression analysis under different light qualities and intensities

    • Examination of MLO1 levels in photoreceptor mutants

    • Chromatin immunoprecipitation studies to identify light-responsive transcription factors binding to the MLO1 promoter

    • Further investigation of the connection between MLO1 and the methylerythritol 4-phosphate pathway

  • Integration with stress response networks:

    • Parallel analysis of MLO1 expression under various abiotic stresses (heat, cold, drought)

    • Identification of common signaling components between diurnal regulation and stress responses

    • Network analysis to position MLO1 within broader stress-responsive gene networks

  • Calcium signaling dynamics:

    • Investigation of whether calcium oscillations follow similar diurnal patterns

    • Analysis of whether calcium-dependent calmodulin binding to MLO1 varies throughout the day

    • Examination of calcium channel activity in relation to MLO1 expression patterns

Understanding these connections could reveal how plants integrate light perception, circadian rhythms, and defense responses into coherent physiological strategies. This knowledge would be valuable not only for fundamental plant biology but also for developing crops with enhanced resilience to multiple stresses through targeted modification of key integration nodes like MLO1.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.