Recombinant Oryza sativa subsp. indica Oleosin 18 kDa (OLE18)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
OLE18; OsI_012748; Oleosin 18 kDa; OSE721
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-172
Protein Length
Full Length of Mature Protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
OLE18
Target Protein Sequence
ADRDRAGQYYQQQRGQVGETVKGILPEKAPSASQALTVATLFPLGGLLLVLSGLALAASV VGLAVATPVFLIFSPVLVPAALLIGLAVAGFLTSGALGLGGLSSLTFLANTARQAFQRTP DYVEQARRRMAEAAAHAGHKTAQAGHAIQGRADQAGTGAGAGGGAGTKTSS
Uniprot No.

Target Background

Function
OLE18 likely plays a structural role in stabilizing lipid bodies during seed desiccation by preventing oil coalescence. It probably interacts with both lipid and phospholipid components of lipid bodies. It may also provide recognition signals for specific lipase binding during lipolysis in seedling growth.
Database Links
Protein Families
Oleosin family
Subcellular Location
Lipid droplet. Membrane; Multi-pass membrane protein. Note=Surface of oil bodies. Oleosins exist at a monolayer lipid/water interface.

Q&A

What is the basic structure of OLE18 and how does it compare to other plant oleosins?

OLE18 from Oryza sativa subsp. indica follows the conserved tripartite structure common to all plant oleosins. This structure consists of:

  • A hydrophilic N-terminal domain that extends into the cytoplasm

  • A highly conserved hydrophobic central domain forming a hairpin-like structure with a proline knot motif

  • A hydrophilic C-terminal α-helical domain also exposed to the cytoplasm

The central domain is particularly important as it anchors the protein in the oil body (OB) membrane, with the hairpin structure penetrating into the triacylglycerol matrix . This domain is highly conserved across plant species, while the N- and C-terminal regions show greater variability, suggesting they may have evolved for species-specific functions. In comparison with maize oleosins like KD 18, rice OLE18 maintains the same structural organization, though sequence homology is highest in the central domain (approximately 70-72% similarity) .

How do post-translational modifications affect OLE18 functionality?

OLE18, like other oleosins, undergoes several critical post-translational modifications that influence its stability, localization, and function:

  • N-terminal processing: The initial methionine is typically removed, and the newly exposed N-terminal alanine becomes acetylated by N-terminal acetyltransferases (NATs), potentially NatA

  • Deamidation: Glutamine residues in the N-terminus may undergo deamidation, introducing negative charges to the protein surface and potentially preventing aggregation

  • Phosphorylation: During seed germination, specific oleosins undergo phosphorylation, which may serve as a signal for subsequent degradation

  • Ubiquitination: Prior to lipid degradation during germination, oleosins are marked for proteolytic degradation by complex ubiquitination patterns

These modifications collectively contribute to the proper insertion of OLE18 into oil bodies, prevent premature degradation, and regulate its turnover during germination. Researchers should consider these modifications when designing expression systems or investigating OLE18 interactions.

What are the optimal conditions for recombinant expression of OLE18?

For successful recombinant expression of OLE18, consider the following optimized protocol:

  • Expression system: E. coli has been successfully used for OLE18 expression with N-terminal His-tagging

  • Vector selection: pET series vectors under T7 promoter control provide high expression levels

  • Host strain: BL21(DE3) or Rosetta(DE3) strains are recommended, especially if the rice codon usage differs significantly from E. coli

  • Induction conditions:

    • IPTG concentration: 0.5-1.0 mM

    • Induction temperature: Lower temperatures (16-20°C) often improve oleosin folding

    • Duration: Extended expression times (16-20 hours) at lower temperatures

The hydrophobic central domain of oleosins can present challenges for expression. Consider using fusion partners that enhance solubility (such as SUMO or MBP) if the His-tag alone yields poor results.

What purification strategies yield the highest purity and functional integrity of recombinant OLE18?

A multi-step purification approach yields the best results for recombinant OLE18:

  • Initial capture: Ni-NTA affinity chromatography using the N-terminal His-tag

    • Buffer composition: Tris/PBS-based buffer at pH 8.0

    • Include mild detergents (0.1-0.5% Triton X-100 or n-dodecyl-β-D-maltoside) to maintain solubility

    • Elution with imidazole gradient (50-250 mM)

  • Secondary purification: Size exclusion chromatography

    • Separates monomeric OLE18 from potential oligomers or aggregates

    • Buffer: Tris/PBS with 6% trehalose for stability

  • Final preparation:

    • Lyophilization in the presence of 6% trehalose maintains protein integrity

    • Reconstitution in deionized sterile water to 0.1-1.0 mg/mL concentration

    • Addition of 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C

For functional studies, maintaining the native conformation is critical. Avoid repeated freeze-thaw cycles as they significantly reduce protein activity .

How can researchers effectively assess OLE18 integration into artificial oil bodies?

To evaluate OLE18 integration into artificial oil bodies (AOBs), implement this methodological approach:

  • AOB preparation:

    • Mix phospholipids (DOPC/DOPE, 3:1 molar ratio) with triacylglycerols

    • Add purified recombinant OLE18 at varying protein-to-lipid ratios

    • Prepare by sonication or microfluidization to form stable emulsions

  • Assessment techniques:

    • Particle size analysis using dynamic light scattering (DLS)

    • Stability testing through accelerated stress conditions (temperature, pH, ionic strength)

    • Zeta potential measurements to evaluate surface charge

    • Microscopy visualization (confocal microscopy with fluorescently labeled OLE18)

    • Flotation assays to confirm proper integration

  • Data analysis:

    • Compare AOB stability with and without OLE18

    • Assess particle size distribution as a function of OLE18 concentration

    • Measure changes in stability parameters over time

What methods can differentiate between monomeric and oligomeric forms of OLE18?

OLE18, like other oleosins, can form oligomers that may have distinct functional properties. To differentiate between monomeric and oligomeric forms:

  • Biochemical approaches:

    • Native PAGE vs. SDS-PAGE comparison

    • Blue native PAGE for higher resolution of native complexes

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS)

    • Chemical crosslinking followed by SDS-PAGE analysis

  • Biophysical methods:

    • Analytical ultracentrifugation to determine sedimentation coefficients

    • Small-angle X-ray scattering (SAXS) for solution structure

    • Native mass spectrometry for accurate mass determination of complexes

  • Visualization techniques:

    • Negative-stain electron microscopy

    • Cryo-electron microscopy for higher resolution structures

Researchers should note that oleosin oligomerization is observed in multiple species, with dimers, trimers, and higher oligomers reported in peanut (~34 kDa, ~50 kDa, and ~68 kDa bands) . Oligomerization may be physiologically relevant and influenced by extraction conditions, particularly temperature in roasted versus raw preparations .

How does OLE18 from rice compare functionally with oleosins from other crop species?

OLE18 from rice shares fundamental functional properties with oleosins from other species while exhibiting species-specific characteristics:

SpeciesOleosin SizeStructural SimilaritiesFunctional DifferencesReference
Rice (OLE18)18 kDaTripartite structure with hairpin domainPotentially specialized for rice seed oil bodies
Maize (KD 18)18 kDa72% similarity in central domain187 amino acid residues; specific regulatory elements
Arabidopsis (OLEO1)18 kDaSimilar structureAccounts for ~65% of oil body proteins
Peanut18 kDaSimilar core structurePotential allergenicity; forms stable oligomers

The central hydrophobic domain shows the highest conservation across species (particularly the proline knot motif), while the N- and C-terminal regions exhibit greater divergence . This suggests that while the oil body anchoring function is conserved, the exposed portions may have evolved for species-specific functions related to oil body mobilization during germination or interactions with other cellular components.

When using OLE18 as a model for other plant oleosins, researchers should consider these species-specific variations, particularly when designing expression constructs or interpreting interaction studies.

What techniques can resolve contradictory findings about OLE18 function across different experimental systems?

When facing contradictory findings regarding OLE18 function, implement these methodological approaches:

  • System-based validation:

    • Compare heterologous expression systems (E. coli, yeast, insect cells)

    • Validate in plant-based systems using transgenic approaches

    • Establish in vitro reconstitution systems with purified components

  • Functional domain mapping:

    • Generate truncation variants to isolate functional domains

    • Create chimeric proteins with domains from other oleosins

    • Perform site-directed mutagenesis of conserved residues

  • Contextual analysis:

    • Examine protein-protein interactions with co-purified or reconstituted systems

    • Evaluate lipid composition effects on function

    • Consider developmental timing and tissue-specific factors

  • Multi-method confirmation:

    • Apply complementary biophysical techniques

    • Combine genetic, biochemical, and imaging approaches

    • Utilize both in vitro and in vivo systems

For example, contradictory findings regarding oleosin degradation can be resolved by examining ubiquitination patterns across different systems, as research shows oleosins are degraded sequentially (OLE5 first, followed by OLE2 and OLE4, then OLE1 and OLE3) with complex, isoform-specific ubiquitination topologies .

How can OLE18 be utilized in experiments studying lipid mobilization during seed germination?

OLE18 serves as an excellent model protein for investigating lipid mobilization during germination through these experimental approaches:

  • Time-course analysis:

    • Track OLE18 modifications (phosphorylation, ubiquitination) during germination

    • Correlate OLE18 degradation with lipid mobilization

    • Monitor changes in oil body morphology and composition

  • Genetic manipulation strategies:

    • RNAi suppression of OLE18 expression to alter oil body stability

    • Site-directed mutagenesis of potential modification sites

    • Overexpression studies to evaluate dose-dependent effects

  • Biochemical investigations:

    • Identify interacting proteins during germination (proteases, lipases)

    • Characterize post-translational modifications by mass spectrometry

    • Evaluate changes in lipid composition using lipidomics

Previous studies with Arabidopsis oleosins demonstrated that RNAi suppression of oleosin expression affected both lipid and protein composition in seeds, with oleosin-suppressed lines showing reduced lipid content (32.9% vs. 40.3% in wild type) and increased protein content (33.9% vs. 25.1%) , as shown in this comparative data:

GenotypeLipid (%)Protein (%)Starch (%)Sucrose (%)
Wild type (C24)40.3 ± 1.425.1 ± 1.70.5 ± 0.33.2 ± 0.4
SupOLEO1-Loop32.9 ± 2.033.9 ± 1.60.8 ± 0.42.8 ± 0.2
Wild-type (Col-0)36.1 ± 1.635.9 ± 2.40.7 ± 0.12.9 ± 0.3
KnockOLEO130.3 ± 0.939.9 ± 1.30.8 ± 0.32.9 ± 0.1
KnockOLEO234.1 ± 1.535.8 ± 2.80.8 ± 0.42.2 ± 0.3

What are the considerations for using OLE18 in artificial oil body systems for biotechnology applications?

When developing artificial oil body (AOB) systems using OLE18, consider these critical factors:

  • Protein design considerations:

    • Preserve the complete tripartite structure (including proline knot)

    • Maintain critical post-translational modifications

    • Consider fusion strategies for introducing new functionalities

  • Lipid composition optimization:

    • Phospholipid composition affects stability and protein integration

    • Triacylglycerol composition influences core properties

    • Lipid:protein ratio determines surface properties

  • Formation process variables:

    • Temperature, pH, and ionic strength during assembly

    • Mechanical energy input (sonication, homogenization, microfluidics)

    • Order of component addition impacts final structure

  • Stability enhancement strategies:

    • Co-expression with other oil body proteins (caleosins, steroleosins)

    • Introduction of stabilizing agents (e.g., trehalose)

    • Control of particle size distribution

  • Functional assessment parameters:

    • Physical stability (size, zeta potential, aggregation resistance)

    • Chemical stability (oxidation resistance, pH tolerance)

    • Encapsulation efficiency for target molecules

Remember that while the central hydrophobic domain is essential for oil body targeting, the N- and C-terminal domains may undergo substantial modifications without compromising the structural integrity of the oil bodies , offering flexibility for biotechnological adaptations.

What are common pitfalls in OLE18 expression and purification, and how can they be addressed?

Researchers frequently encounter these challenges when working with OLE18:

  • Low expression yields:

    • Problem: Hydrophobic central domain leads to poor solubility

    • Solution: Lower induction temperature (16-20°C), use specialized strains (C41/C43), consider fusion partners (SUMO, MBP)

  • Protein aggregation:

    • Problem: Improper folding of the hydrophobic domain

    • Solution: Include mild detergents (0.1-0.5% n-dodecyl-β-D-maltoside), add lipids during extraction, use 6% trehalose as a stabilizer

  • Loss of activity after purification:

    • Problem: Structural changes during purification

    • Solution: Minimize purification steps, avoid harsh elution conditions, add glycerol (5-50%) for storage

  • Inconsistent results between preparations:

    • Problem: Variability in oligomerization states

    • Solution: Standardize heating/cooling procedures, include size exclusion chromatography as a final step

  • Degradation during storage:

    • Problem: Instability in solution

    • Solution: Store as lyophilized powder, avoid repeated freeze-thaw cycles, aliquot samples before freezing

  • Poor reconstitution into oil bodies:

    • Problem: Incorrect protein:lipid ratios

    • Solution: Optimize protein:phospholipid:oil ratios, ensure gradual mixing procedures

Remember that recombinant OLE18 may lack some post-translational modifications present in the native protein, potentially affecting its behavior in experimental systems.

How can researchers validate that recombinant OLE18 maintains native structural properties?

To confirm that recombinant OLE18 maintains its native structural properties, implement these validation approaches:

  • Secondary structure analysis:

    • Circular dichroism (CD) spectroscopy to assess α-helical and β-sheet content

    • Fourier-transform infrared spectroscopy (FTIR) for additional structural information

  • Tertiary structure assessment:

    • Intrinsic fluorescence spectroscopy (tryptophan emission)

    • Nuclear magnetic resonance (NMR) for solution structure determination

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

  • Thermal stability evaluation:

    • Differential scanning calorimetry (DSC)

    • Thermofluor assays using hydrophobic dyes

    • Temperature-dependent CD measurements

  • Functional validation:

    • Oil body binding assays with fluorescently labeled protein

    • Comparison of oil body formation efficiency with native protein

    • Oil body stabilization under various stress conditions

  • Mass spectrometry analysis:

    • Verification of N-terminal processing (methionine removal, alanine acetylation)

    • Detection of other post-translational modifications (phosphorylation, deamidation)

It's essential to compare results from recombinant OLE18 with native protein isolated from rice oil bodies whenever possible. Notable differences might indicate missing modifications or alternative folding in the recombinant system.

What emerging techniques could advance our understanding of OLE18's role in oil body biogenesis?

Several cutting-edge approaches show promise for elucidating OLE18's role in oil body biogenesis:

  • Advanced imaging technologies:

    • Super-resolution microscopy to visualize OLE18 during oil body formation

    • Correlative light and electron microscopy (CLEM) for structural-functional insights

    • Live-cell imaging with fluorescently tagged OLE18 to track dynamics

  • Proximity-based protein interaction mapping:

    • BioID or TurboID proximity labeling to identify transient interactions

    • Split-GFP complementation to visualize protein interactions in situ

    • FRET/FLIM analyses for nanoscale proximity detection

  • Structural biology approaches:

    • Cryo-electron microscopy of oil bodies with embedded OLE18

    • Solid-state NMR to study membrane-embedded domains

    • X-ray crystallography of individual domains with fusion partners

  • Systems biology integration:

    • Multi-omics approaches (proteomics, lipidomics, metabolomics)

    • Network analysis of OLE18 interactions during development

    • Mathematical modeling of oil body formation kinetics

  • Advanced genetic techniques:

    • CRISPR/Cas9 gene editing for precise modification of endogenous OLE18

    • Optogenetic control of OLE18 expression or degradation

    • Single-cell transcriptomics during oil body formation

These approaches could help resolve the temporal sequence of events during oil body formation and clarify how the tripartite structure of OLE18 facilitates its function as both a structural protein and potentially as a regulator of lipid metabolism.

How might researchers investigate the potential regulatory functions of OLE18 beyond structural roles?

To explore OLE18's non-structural regulatory functions, consider these research approaches:

  • Interactome analysis:

    • Affinity purification-mass spectrometry with different domains of OLE18

    • Yeast two-hybrid screening with N- and C-terminal domains

    • Protein arrays to identify novel interactions

  • Post-translational modification mapping:

    • Comprehensive phosphoproteomics during development

    • Analysis of ubiquitination patterns and their triggers

    • Investigation of other modifications (acetylation, methylation)

  • Lipid metabolism connections:

    • Lipidomic analysis in OLE18 knockout/overexpression lines

    • Activity assays for lipid-modifying enzymes in the presence of OLE18

    • Binding studies with specific lipid species

  • Signal transduction investigations:

    • Evaluation of OLE18 in hormone signaling pathways

    • Analysis of OLE18 modification in response to stress

    • Identification of transcription factors regulating OLE18 expression

  • Evolutionary biology approaches:

    • Comparative analysis across species to identify conserved regulatory motifs

    • Reconstruction of ancestral sequences to trace functional evolution

    • Analysis of selection pressures on different protein domains

The three-domain structure of oleosins, with the central domain being highly conserved while the N- and C-terminal domains show greater variation, suggests that these terminal domains may have evolved specialized regulatory functions beyond structural roles . Understanding these functions could provide insights into the coordination of lipid metabolism during seed development and germination.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.