Recombinant Oryza sativa subsp. indica Peroxisomal membrane protein 11-4 (PEX11-4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted upon request.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, we can prioritize the development of a specified tag type if provided in advance.
Synonyms
PEX11-4; OsI_016204; OSIGBa0159I10.12; Peroxisomal membrane protein 11-4; OsPEX11-4; Peroxin-11-4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-222
Protein Length
full length protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
PEX11-4
Target Protein Sequence
MSAGDTLDKLVVFLAKRDGIDKLVKTFQYVSKLAHWAAESSSPGLAGRAKNWETSAGLSR KAFRTGRFLTGLNGLRRAPGEFGALAVLANAGEMVYFFFDHFTWLSRVGVLDAWLARRMS FISAFGESVGYVFFIAMDLIMIRRGLRQERKLLREGGKDKDKEVKKIRMDRVMRLMATAA NVADLVIGIADIEPNPFCNHAVTLGISGLVSAWAGWYRNWPS
Uniprot No.

Target Background

Function
Involved in peroxisomal proliferation.
Database Links
Protein Families
Peroxin-11 family
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in seedlings, shoots, leaf sheaths and flag leaf.

Q&A

What is PEX11-4 and what is its role in plant cells?

PEX11-4 (Peroxisomal membrane protein 11-4) is an integral membrane protein found in peroxisomes of rice (Oryza sativa subsp. indica). PEX11 proteins serve as key factors in peroxisome elongation, tubulation, and division. In plants, PEX11 homologs form multigene families and are categorized into different subfamilies based on sequence similarity .

The primary functions of PEX11-4 include:

  • Regulation of peroxisome proliferation

  • Contribution to peroxisome membrane remodeling

  • Involvement in peroxisome elongation and division processes

  • Participation in cellular responses to environmental stimuli

Plant peroxisomes are essential organelles involved in numerous processes including primary and secondary metabolism, development, and responses to both abiotic and biotic stresses . As a key component of peroxisome dynamics, PEX11-4 contributes significantly to these functions.

How should recombinant PEX11-4 be stored and handled in the laboratory?

Proper storage and handling of recombinant PEX11-4 is crucial for maintaining protein stability and functionality:

Storage ConditionRecommendation
Long-term Storage-20°C/-80°C, with aliquoting necessary for multiple use
Working AliquotsStore at 4°C for up to one week
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
AvoidRepeated freeze-thaw cycles

Reconstitution Protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended default: 50%)

  • Aliquot for long-term storage at -20°C/-80°C

This protocol helps maintain protein stability and prevents degradation during experimental procedures .

What applications is recombinant PEX11-4 suitable for?

Recombinant PEX11-4 protein can be used for various research applications:

  • Protein-Protein Interaction Studies: Investigating interactions between PEX11-4 and other peroxisomal proteins

  • Antibody Production: Generating specific antibodies against PEX11-4 for immunological detection

  • Functional Assays: Studying peroxisome proliferation mechanisms

  • SDS-PAGE Analysis: Characterizing protein expression and purity

  • Western Blotting: Detecting PEX11-4 expression in various tissues or experimental conditions

  • Enzyme Activity Assays: When exploring potential enzymatic functions

  • Structural Studies: Understanding the protein's conformation and domain organization

It's important to note that commercially available recombinant PEX11-4 is intended for research use only and is not for human consumption .

How does PEX11-4 function differ from other PEX11 isoforms in rice and other plant species?

PEX11 proteins form multigene families in various plant species with distinct functional roles. In Arabidopsis, for example, five PEX11 homologs are categorized into three subfamilies based on sequence: PEX11a, PEX11b, and PEX11c-e . While specific data on rice PEX11 isoforms is limited in the provided search results, comparative analysis suggests functional differences:

PEX11 IsoformFunctional CharacteristicsSpecies-Specific Notes
PEX11-4 (Rice)Integral membrane protein involved in peroxisome elongationLocated in peroxisomal membranes of rice
PEX11 (Arabidopsis)Five isoforms capable of inducing peroxisome elongation/number increaseFunctions conserved but with potential specialization
PEX11 (Yeast)First identified peroxisome division protein; null mutants contain giant peroxisomesServes as model for understanding function

The expression of PEX11 genes is regulated by the cell cycle in Arabidopsis synchronized cell cultures, correlating with peroxisome division events . This suggests a coordinated regulation of PEX11 isoforms during plant development and growth.

What experimental approaches are most effective for studying PEX11-4 membrane integration and topology?

To effectively study PEX11-4 membrane integration and topology, researchers can employ multiple complementary approaches:

  • Protease Protection Assays:

    • Isolate intact peroxisomes containing PEX11-4

    • Treat with proteases with/without membrane permeabilization

    • Analyze protected fragments to determine membrane-embedded regions

  • Fluorescence Microscopy with Tagged Constructs:

    • Generate N- and C-terminal fluorescent protein fusions

    • Express in plant cells to determine subcellular localization

    • Use differential permeabilization to assess topology

  • Membrane Fractionation Studies:

    • Separate integral from peripheral membrane proteins using carbonate extraction

    • Use detergent solubilization profiles to characterize membrane association

  • Computational Prediction and Validation:

    • Predict transmembrane domains using bioinformatics tools

    • Validate predictions using site-directed mutagenesis

    • Assess effects on membrane integration and function

  • Cysteine Scanning Mutagenesis:

    • Introduce cysteine residues at various positions

    • Use membrane-impermeable sulfhydryl reagents to identify exposed regions

    • Map accessible versus inaccessible regions to determine topology

Based on the available sequence information for PEX11-4, its hydrophobic regions suggest it is an integral membrane protein with multiple potential membrane-spanning domains . Experimental validation of these predictions would contribute significantly to understanding PEX11-4's molecular mechanism.

How can I optimize expression and purification of recombinant PEX11-4 for structural studies?

Optimizing expression and purification of recombinant PEX11-4 for structural studies requires addressing several challenges associated with membrane proteins:

Expression Optimization:

ParameterOptimization Strategy
Expression SystemTest multiple E. coli strains (BL21(DE3), C41(DE3), Rosetta)
Induction ConditionsVary IPTG concentration (0.1-1.0 mM), temperature (16-37°C), and duration (4-24h)
Media CompositionTry rich media (LB, TB, 2YT) and minimal media with supplements
Fusion TagsCompare N-terminal vs. C-terminal His-tags; test MBP, GST, or SUMO fusion
Co-expressionInclude molecular chaperones to improve folding

Purification Protocol:

  • Cell Lysis and Membrane Isolation:

    • Use gentle lysis methods (French press or sonication with cooling)

    • Isolate membrane fraction by ultracentrifugation

    • Solubilize membranes with appropriate detergents

  • Detergent Screening:

    • Test mild detergents (DDM, LDAO, OG) at various concentrations

    • Assess protein stability and monodispersity by size exclusion chromatography

  • Affinity Purification:

    • Optimize binding conditions (imidazole concentration, pH, salt)

    • Include detergent in all purification buffers

  • Size Exclusion Chromatography:

    • Remove aggregates and assess oligomeric state

    • Collect monodisperse fractions for structural studies

  • Quality Control:

    • Verify purity by SDS-PAGE (>95% for structural studies)

    • Assess secondary structure by circular dichroism

    • Check homogeneity by dynamic light scattering

For crystallization trials, consider using bicelles or lipidic cubic phase methods that may better accommodate membrane proteins compared to traditional vapor diffusion techniques.

What methods can be used to investigate the role of PEX11-4 in peroxisome proliferation in rice cells?

To investigate PEX11-4's role in peroxisome proliferation in rice cells, researchers can employ several complementary approaches:

  • Gene Knockout/Knockdown Studies:

    • Generate CRISPR/Cas9 knockout lines targeting PEX11-4

    • Create RNAi lines for partial knockdown

    • Analyze peroxisome number, size, and morphology in mutant lines

  • Overexpression Studies:

    • Express PEX11-4 under constitutive or inducible promoters

    • Quantify changes in peroxisome number and morphology

    • Assess effects on plant growth and stress responses

  • Live Cell Imaging:

    • Generate transgenic rice expressing peroxisome markers (e.g., RFP-SKL)

    • Use confocal microscopy to track peroxisome dynamics in real-time

    • Apply 3D reconstruction and time-lapse imaging to capture division events

  • Electron Microscopy:

    • Employ transmission electron microscopy to visualize ultrastructural changes

    • Use immunogold labeling to localize PEX11-4 within peroxisomes

    • Analyze membrane curvature and division intermediates

  • Biochemical Interaction Studies:

    • Identify PEX11-4 interacting partners using co-immunoprecipitation

    • Perform yeast two-hybrid or split-ubiquitin assays for membrane proteins

    • Validate interactions in planta using bimolecular fluorescence complementation

  • Transcriptomic and Proteomic Analysis:

    • Compare wild-type and PEX11-4 mutant expression profiles

    • Identify downstream pathways affected by PEX11-4 manipulation

    • Correlate changes with peroxisome proliferation phenotypes

Evidence from studies in other organisms suggests that PEX11 proteins are key mediators of peroxisome elongation and division. In yeast, PEX11 null mutants contain one or two giant peroxisomes per cell, while overexpression leads to increased peroxisome numbers . Similar phenotypes would be expected in rice if PEX11-4 functions are conserved.

How does PEX11-4 expression and function change under various stress conditions in rice?

PEX11-4 expression and function likely change under various stress conditions, reflecting the important role of peroxisomes in plant stress responses. While specific data on rice PEX11-4 stress responses is limited in the provided search results, we can propose a research framework to investigate this question:

Potential Stress-Related Changes in PEX11-4:

Stress ConditionExpected ResponseExperimental Approach
Oxidative StressUpregulation to increase peroxisome numbers for ROS detoxificationH₂O₂ treatment, paraquat exposure
Drought StressAltered expression to modulate fatty acid β-oxidationControlled water limitation experiments
Salt StressChanges in peroxisome dynamics to support proline metabolismNaCl gradient treatments
Pathogen AttackPotential involvement in defense responsesBacterial/fungal pathogen exposure
Temperature StressAdaptation of peroxisome function for altered metabolismCold/heat shock experiments

Research Methods to Investigate Stress Responses:

  • Transcriptional Analysis:

    • RT-qPCR to quantify PEX11-4 expression under various stresses

    • RNA-seq to identify co-regulated genes in stress response networks

    • Promoter analysis to identify stress-responsive elements

  • Protein Level Analysis:

    • Western blotting to measure PEX11-4 protein abundance

    • Pulse-chase experiments to determine protein stability under stress

    • Post-translational modification assessment using mass spectrometry

  • Functional Analysis:

    • Compare stress sensitivity of wild-type and PEX11-4 mutant plants

    • Assess peroxisome proliferation rates under stress conditions

    • Measure peroxisomal enzyme activities during stress responses

  • Signaling Pathway Investigation:

    • Identify upstream regulators controlling PEX11-4 expression

    • Determine if PEX11-4 is regulated by stress hormones (ABA, ethylene, SA, JA)

    • Analyze stress-related transcription factor binding to PEX11-4 promoter

Plant peroxisomes are known to be involved in numerous processes including responses to abiotic and biotic stresses . Understanding how PEX11-4 contributes to these responses would provide valuable insights into rice stress adaptation mechanisms.

What are the best approaches to study protein-protein interactions involving PEX11-4?

Studying protein-protein interactions involving membrane proteins like PEX11-4 requires specialized approaches:

  • Split-Ubiquitin Yeast Two-Hybrid System:

    • Specifically designed for membrane proteins

    • Allows screening of interaction partners in a cellular context

    • Protocol outline:
      a. Clone PEX11-4 as bait fused to C-terminal ubiquitin fragment
      b. Screen against prey library fused to N-terminal ubiquitin fragment
      c. Interaction reconstitutes ubiquitin, releasing transcription factor
      d. Positive interactions identified by reporter gene activation

  • Co-Immunoprecipitation with Membrane Solubilization:

    • Preserves native interactions while extracting membrane proteins

    • Experimental workflow:
      a. Solubilize membranes with mild detergents (digitonin, DDM)
      b. Immunoprecipitate using anti-His antibodies (for recombinant His-tagged PEX11-4)
      c. Identify co-precipitated proteins by mass spectrometry
      d. Validate interactions by reciprocal co-IP or other methods

  • Bimolecular Fluorescence Complementation (BiFC):

    • Visualizes interactions in planta in their native cellular context

    • Implementation:
      a. Fuse PEX11-4 to N-terminal half of fluorescent protein
      b. Fuse candidate interactors to C-terminal half
      c. Co-express in rice protoplasts or stable transgenic plants
      d. Visualize reconstituted fluorescence by confocal microscopy

  • Proximity-Dependent Biotin Identification (BioID):

    • Maps protein interactions in native cellular environments

    • Method:
      a. Fuse PEX11-4 to a promiscuous biotin ligase (BirA*)
      b. Express in rice cells and provide biotin
      c. Identify biotinylated proximity proteins by streptavidin pulldown
      d. Analyze by mass spectrometry

  • Förster Resonance Energy Transfer (FRET):

    • Detects interactions with spatial resolution in living cells

    • Approach:
      a. Generate PEX11-4 fused to donor fluorophore (e.g., CFP)
      b. Create potential interactors fused to acceptor fluorophore (e.g., YFP)
      c. Co-express and measure energy transfer using spectral imaging
      d. Calculate FRET efficiency to quantify interaction strength

When studying PEX11-4 interactions, it's particularly important to consider the membrane environment and potential conformational changes that may occur during peroxisome proliferation processes.

How can I analyze the effects of PEX11-4 mutations on peroxisome morphology?

Analyzing the effects of PEX11-4 mutations on peroxisome morphology requires a combination of genetic engineering, microscopy techniques, and quantitative analysis:

Mutation Design and Generation:

  • Site-Directed Mutagenesis Approach:

    • Target conserved residues based on sequence alignment with other PEX11 proteins

    • Focus on potential functional domains:

      • Membrane-spanning regions

      • Potential oligomerization interfaces

      • Regions with high conservation across species

    • Create both point mutations and truncations/deletions

  • CRISPR/Cas9 Genome Editing:

    • Generate precise mutations in the endogenous PEX11-4 gene

    • Create knock-in lines expressing fluorescently tagged mutant versions

    • Develop complete knockout lines as controls

Morphological Analysis Protocol:

  • Sample Preparation:

    • Generate transgenic rice lines expressing the mutations

    • Create double transgenic lines with peroxisome markers (e.g., RFP-SKL)

    • Prepare protoplasts or tissue sections for microscopy

  • Microscopy Techniques:

    • Confocal microscopy for 3D visualization of peroxisome morphology

    • Super-resolution microscopy for detailed membrane structure

    • Time-lapse imaging to capture dynamic morphological changes

    • Transmission electron microscopy for ultrastructural analysis

  • Quantitative Parameters to Measure:

ParameterMeasurement MethodExpected Impact of Mutation
Peroxisome NumberAutomated counting in standardized cell volumesMay decrease in loss-of-function mutations
Peroxisome SizeArea/volume measurements using image analysis softwareMay increase if division is impaired
Elongation IndexRatio of major to minor axisMay decrease if membrane remodeling is affected
Clustering IndexNearest neighbor analysisMay reveal defects in peroxisome distribution
Membrane CurvatureEM analysis with membrane tracingMay identify specific roles in membrane shaping
  • Data Analysis and Interpretation:

    • Apply statistical analysis to quantify differences between wild-type and mutants

    • Correlate morphological changes with functional impacts on peroxisomal pathways

    • Build structure-function relationship models for PEX11-4 domains

In yeast, PEX11 null mutants contain one or two giant peroxisomes per cell, while overexpression leads to elongation/tubulation and/or increased numbers of peroxisomes . Similar phenotypes would be expected for rice PEX11-4 mutations that affect key functional domains.

What methods can be used to visualize PEX11-4 dynamics during peroxisome proliferation?

Visualizing PEX11-4 dynamics during peroxisome proliferation requires advanced imaging techniques that can capture both spatial and temporal aspects of protein behavior:

Fluorescent Protein Fusion Approaches:

  • GFP-PEX11-4 Fusion Construct Design:

    • Create N- and C-terminal fusions to determine optimal orientation

    • Use small fluorescent tags (mNeonGreen, mScarlet) to minimize functional interference

    • Include flexible linkers to prevent steric hindrance

    • Generate stable transgenic rice lines with native or inducible promoters

  • Advanced Microscopy Techniques:

    • Spinning disk confocal microscopy for high-speed imaging

    • Lattice light-sheet microscopy for reduced photodamage during long-term imaging

    • Single-molecule localization microscopy for nanoscale distribution analysis

    • FRAP (Fluorescence Recovery After Photobleaching) to measure protein mobility

  • Multi-color Imaging Strategy:

  • 4D Imaging and Analysis:

    • Establish consistent time intervals for capturing dynamics (e.g., every 10 seconds)

    • Acquire Z-stacks to capture complete peroxisome volumes

    • Apply deconvolution for improved resolution

    • Utilize computational tracking algorithms to follow individual peroxisomes

  • Correlative Light and Electron Microscopy (CLEM):

    • Capture fluorescence data on PEX11-4 localization

    • Process the same sample for electron microscopy

    • Correlate protein localization with ultrastructural features

    • Gain insights into membrane remodeling events at nanoscale resolution

  • Quantitative Analysis Parameters:

    • Measure enrichment of PEX11-4 at specific peroxisome subdomains

    • Track protein redistribution during elongation and constriction events

    • Quantify correlation between PEX11-4 concentration and membrane curvature

    • Analyze temporal relationship between PEX11-4 recruitment and division events

These approaches would help determine whether PEX11-4 functions similarly to Arabidopsis PEX11 proteins, which are capable of inducing peroxisome elongation and/or number increase .

How does post-translational modification affect PEX11-4 function and localization?

Post-translational modifications (PTMs) likely play critical roles in regulating PEX11-4 function and localization. While specific data on rice PEX11-4 PTMs is not provided in the search results, we can outline research approaches to investigate this important aspect:

Identification of Potential PTMs:

  • Computational Prediction:

    • Analyze PEX11-4 sequence for potential modification sites:

      • Phosphorylation sites (Ser, Thr, Tyr residues)

      • Ubiquitination sites (Lys residues)

      • S-acylation/palmitoylation sites (Cys residues)

      • Other modifications (glycosylation, SUMOylation)

  • Mass Spectrometry-Based Identification:

    • Purify PEX11-4 from rice tissues under different conditions

    • Perform LC-MS/MS analysis with PTM-specific enrichment strategies

    • Map identified modifications to the protein sequence

    • Quantify modification stoichiometry under various conditions

Functional Analysis of PTMs:

PTM TypeExperimental ApproachExpected Functional Impact
PhosphorylationSite-directed mutagenesis (S/T→A or S/T→E)May regulate protein-protein interactions or membrane association
UbiquitinationK→R mutations, deubiquitinase treatmentsCould affect protein turnover or signal transduction
S-acylationC→S mutations, hydroxylamine treatmentMight modulate membrane integration or subdomain targeting
SUMOylationSUMO site mutations, SUMO protease treatmentsMay influence protein activity or complex formation
  • PTM-Specific Experimental Approaches:

    • Phosphorylation Studies:

      • Identify kinases/phosphatases acting on PEX11-4

      • Test effects of phosphorylation site mutations on peroxisome proliferation

      • Use phospho-specific antibodies to track modification dynamics

    • Ubiquitination Analysis:

      • Determine if PEX11-4 undergoes condition-dependent degradation

      • Identify E3 ligases targeting PEX11-4

      • Investigate non-degradative roles of ubiquitination

    • Membrane Association Studies:

      • Test if S-acylation affects PEX11-4 membrane integration

      • Determine if PTMs regulate lateral mobility within the membrane

      • Analyze how modifications affect protein topology

  • Cellular Dynamics of PTMs:

    • Develop PTM-specific biosensors for live-cell imaging

    • Track modification status during peroxisome proliferation events

    • Correlate PTM patterns with cell cycle phases or stress responses

    • Map temporal sequence of modifications during peroxisome division

Understanding the PTM landscape of PEX11-4 would provide valuable insights into how its activity is regulated during peroxisome proliferation and in response to various cellular signals.

What are the challenges and solutions for crystallizing membrane proteins like PEX11-4?

Crystallizing membrane proteins like PEX11-4 presents significant challenges due to their hydrophobic nature and reliance on lipid environments. Here's a comprehensive overview of the challenges and potential solutions:

Major Challenges in PEX11-4 Crystallization:

  • Protein Production Issues:

    • Low expression yields in heterologous systems

    • Potential toxicity to host cells

    • Protein misfolding and aggregation

    • Conformational heterogeneity

  • Membrane Extraction Complications:

    • Finding optimal detergents for solubilization

    • Maintaining native protein conformation

    • Preventing aggregation during purification

    • Balancing detergent concentration with protein stability

  • Crystallization Barriers:

    • Limited polar surface area for crystal contacts

    • Detergent micelle interference with crystal packing

    • Conformational flexibility inhibiting regular lattice formation

    • Phase separation issues in crystallization drops

Innovative Solutions and Approaches:

ChallengeConventional ApproachAdvanced Solutions
ExpressionE. coli with His-tagCell-free expression systems; specialized hosts (P. pastoris)
Membrane ExtractionDetergent screeningNanodiscs; amphipols; styrene maleic acid copolymer lipid particles (SMALPs)
Crystal ContactsDetergent optimizationAntibody fragment (Fab) co-crystallization; fusion with crystallization chaperones
Crystallization MethodVapor diffusionLipidic cubic phase (LCP); bicelle crystallization
Structure DeterminationX-ray crystallographyCryo-electron microscopy; microcrystal electron diffraction (MicroED)

Practical Implementation Strategy:

  • Protein Engineering for Crystallization:

    • Remove flexible regions identified by limited proteolysis

    • Introduce surface mutations to enhance crystal contacts

    • Consider fusion partners (T4 lysozyme, BRIL, thermostabilized GFP)

    • Create thermostabilized variants through alanine-scanning mutagenesis

  • Alternative Membrane Mimetics:

    • Test nanodiscs with various lipid compositions

    • Explore newly developed detergent alternatives (maltose-neopentyl glycol compounds)

    • Consider detergent-free approaches using SMALPs

  • Crystallization Screening Strategy:

    • Design sparse matrix screens specifically for membrane proteins

    • Implement in meso crystallization using monoolein LCP

    • Explore bicelle crystallization using DMPC/CHAPSO mixtures

    • Consider microseeding to promote crystal nucleation

  • Complementary Structural Approaches:

    • Apply single-particle cryo-EM for detergent-solubilized protein

    • Use NMR for structure determination of specific domains

    • Consider computational modeling guided by experimental constraints

While crystallizing PEX11-4 would be challenging, solving its structure would provide unprecedented insights into peroxisome membrane dynamics and the molecular mechanisms of peroxisome proliferation.

How conserved is PEX11-4 across different plant species, and what does this tell us about its function?

Examining the evolutionary conservation of PEX11-4 across plant species provides valuable insights into its functional importance and specialization:

Conservation Analysis Approach:

  • Sequence Conservation Assessment:

    • Perform multiple sequence alignments of PEX11 homologs across plant species

    • Identify highly conserved domains and residues

    • Map conservation onto predicted structural features

    • Compare plant PEX11 proteins with fungal and animal homologs

  • Phylogenetic Analysis:

    • Construct phylogenetic trees of PEX11 family members

    • Determine when gene duplication events occurred in plant lineages

    • Analyze evolutionary rates across different domains of the protein

    • Identify signatures of positive or purifying selection

Functional Implications of Conservation:

Based on limited information from the search results, we can make some observations about PEX11 conservation:

  • PEX11 homologs have been identified as multigene families in various lineages

  • Arabidopsis has five PEX11 homologs categorized into three subfamilies based on sequence (PEX11a, PEX11b, and PEX11c to e)

  • Heterologous expression of plant or mammalian PEX11 homologs complements yeast mutant phenotypes to various degrees, demonstrating the conserved role of PEX11 across kingdoms

This suggests that while core functions of PEX11 proteins are conserved, there may be species-specific adaptations and specializations. The presence of multiple isoforms in plants indicates potential functional diversification, possibly related to specific metabolic or developmental needs.

A detailed analysis comparing rice PEX11-4 with homologs from other plants would help identify:

  • Conserved functional motifs that are likely critical for core functions

  • Variable regions that may confer species-specific functions

  • Potential regulatory elements that have evolved differently across species

This evolutionary perspective would provide a framework for understanding which aspects of PEX11-4 function are fundamental to all plants versus those that might be specific to rice or other cereal crops.

How does research on PEX11-4 contribute to our understanding of peroxisome-related diseases?

Although PEX11-4 from rice is primarily of interest for plant biology, research on this protein family has broader implications for understanding peroxisome-related diseases in humans:

Translational Relevance of PEX11 Research:

  • Conserved Mechanisms in Peroxisome Biogenesis:

    • Fundamental mechanisms of peroxisome division are conserved across eukaryotes

    • Plant research can reveal basic principles applicable to human peroxisomal disorders

    • Insights from plant PEX11 studies may inform therapeutic approaches for human diseases

  • Peroxisomal Disorders with PEX11 Involvement:

    • Human PEX11β mutations are associated with peroxisome biogenesis disorders

    • Understanding structure-function relationships in plant PEX11 proteins can provide insights into human disease mechanisms

    • Phenotypes observed in plant models may suggest unexplored consequences of peroxisome dysfunction

  • Comparative Advantages of Plant Models:

    • Plant systems offer simplified genetic backgrounds for studying basic peroxisome biology

    • Plant PEX11 research can identify novel peroxisome regulatory mechanisms potentially relevant to human health

    • High-throughput screening approaches in plants can identify compounds affecting peroxisome dynamics

Research Connections Between Plant and Human Peroxisome Biology:

AspectPlant PEX11 ResearchRelevance to Human Disease
Peroxisome MorphologyMechanisms of elongation and divisionSimilar processes disrupted in Zellweger spectrum disorders
Metabolic FunctionsRole in fatty acid oxidation and ROS metabolismCore metabolic functions affected in peroxisomal disorders
Stress ResponsesAdaptation to environmental challengesPotential insights into peroxisome stress responses in disease states
Protein InteractionsIdentification of PEX11 interaction networksMay reveal novel players in peroxisome biogenesis disorders

The study of PEX11-4 in rice contributes to the broader understanding of peroxisome biology across species, potentially revealing conserved mechanisms that could inform therapeutic approaches for human peroxisomal disorders.

What emerging technologies could advance our understanding of PEX11-4 function?

Several cutting-edge technologies hold promise for advancing our understanding of PEX11-4 function and peroxisome dynamics:

  • Advanced Imaging Technologies:

    • Super-resolution Microscopy: Techniques like PALM, STORM, or STED could visualize PEX11-4 distribution at nanoscale resolution, revealing previously undetectable patterns in membrane organization

    • Lattice Light-Sheet Microscopy: Enables long-term 4D imaging with minimal phototoxicity, ideal for capturing dynamic peroxisome division events

    • Cryo-electron Tomography: Could provide structural insights into PEX11-4 arrangement in membranes in a near-native state

  • Proximity Labeling Proteomics:

    • TurboID/miniTurboID Fusion Proteins: These improved biotin ligases allow rapid proximity labeling to map PEX11-4's dynamic interactome during peroxisome proliferation

    • Split-TurboID Systems: Could identify conditional or transient interactions that occur only during specific phases of peroxisome division

  • Genome Editing and Synthetic Biology:

    • CRISPR Base Editing: Allows precise introduction of point mutations without double-strand breaks, ideal for studying specific residues

    • Optogenetic Control Systems: Light-inducible PEX11-4 expression or activity could enable temporal control of peroxisome proliferation

    • Synthetic Organelle Engineering: Designer peroxisomes with modified PEX11-4 variants could test functional hypotheses

  • Single-Cell Technologies:

    • Single-Cell Transcriptomics: Could reveal cell-specific regulation of PEX11-4 expression

    • Single-Cell Proteomics: May identify cell-to-cell variability in PEX11-4 abundance or modifications

    • Live-Cell Metabolomics: Could correlate peroxisome dynamics with metabolic states

  • Structural Biology Advances:

    • AlphaFold2/RoseTTAFold: AI-based structure prediction could provide models of PEX11-4 to guide experimental design

    • Integrative Structural Biology: Combining multiple structural techniques (SAXS, NMR, cryo-EM) to overcome challenges of membrane protein structure determination

    • Time-Resolved Structural Studies: Capturing conformational changes during membrane remodeling events

These emerging technologies could help answer fundamental questions about how PEX11-4 functions at the molecular level to drive peroxisome proliferation and contribute to plant cellular homeostasis.

What are the potential applications of manipulating PEX11-4 expression in crop improvement?

Manipulating PEX11-4 expression in rice and other crops could have several potential applications for crop improvement:

Stress Tolerance Enhancement:

  • Oxidative Stress Resistance:

    • Peroxisomes play crucial roles in ROS detoxification

    • Modulating PEX11-4 expression to increase peroxisome numbers might enhance cellular capacity to manage oxidative stress

    • This could improve crop tolerance to drought, high light, temperature extremes, and heavy metal exposure

  • Pathogen Resistance Development:

    • Plant peroxisomes are involved in defense responses to biotic stresses

    • Optimized PEX11-4 expression might enhance the production of defense-related secondary metabolites

    • Potential for improved resistance to fungal and bacterial pathogens

Metabolic Engineering Applications:

Target Metabolic PathwayPEX11-4 Manipulation StrategyPotential Benefit
Fatty Acid MetabolismIncrease peroxisome abundance through controlled PEX11-4 overexpressionEnhanced seed oil production or quality
PhotorespirationOptimize peroxisome-chloroplast associationsImproved photosynthetic efficiency in C3 plants
Hormone BiosynthesisControl peroxisome numbers in specific tissuesModified plant architecture or developmental timing
Secondary Metabolite ProductionTissue-specific PEX11-4 expressionEnhanced production of valuable compounds

Implementation Approaches:

  • Precision Breeding Tools:

    • CRISPR-based promoter editing to fine-tune PEX11-4 expression levels

    • Introduction of beneficial PEX11-4 alleles from wild relatives or landraces

    • Development of tissue-specific or stress-inducible PEX11-4 expression systems

  • Phenotypic Targets for Improvement:

    • Increased yield under sub-optimal conditions

    • Enhanced germination rates and seedling vigor

    • Improved seed storage characteristics

    • Better post-harvest quality and reduced spoilage

  • Research Prerequisites:

    • Comprehensive understanding of PEX11-4 regulation in target crops

    • Field-based validation of laboratory findings

    • Assessment of potential unintended consequences of altered peroxisome dynamics

Plant peroxisomes are involved in numerous processes, including primary and secondary metabolism, development, and responses to abiotic and biotic stresses . This multifunctional nature makes PEX11-4 a promising target for crop improvement strategies aimed at enhancing plant performance under challenging conditions.

What are the key knowledge gaps in our understanding of PEX11-4 and peroxisome dynamics in plants?

Despite progress in understanding peroxisome biology, significant knowledge gaps remain regarding PEX11-4 and peroxisome dynamics in plants:

  • Molecular Mechanism of PEX11-4 Function:

    • The precise mechanism by which PEX11-4 induces membrane curvature remains unclear

    • How PEX11-4 coordinates with other division factors is not fully understood

    • The regulatory switches controlling PEX11-4 activity have not been comprehensively identified

  • Species-Specific Adaptations:

    • How rice PEX11-4 function differs from other plant species requires further investigation

    • The evolutionary reasons for PEX11 gene family expansion in plants are not completely understood

    • Species-specific regulatory mechanisms controlling PEX11-4 expression need clarification

  • Integration with Cellular Signaling Networks:

    • How environmental signals are transduced to regulate PEX11-4 activity

    • The role of peroxisome proliferation in complex stress responses

    • Cross-talk between peroxisome dynamics and other organelle populations

  • Functional Diversity Among PEX11 Isoforms:

    • The distinct roles of different PEX11 family members in plants

    • Tissue-specific functions of PEX11-4 throughout plant development

    • Potential redundancy and compensatory mechanisms among PEX11 proteins

  • Technological Limitations:

    • Challenges in visualizing peroxisome dynamics at high resolution in intact plants

    • Difficulties in structural characterization of membrane proteins like PEX11-4

    • Limited tools for spatiotemporal control of peroxisome proliferation in planta

Future research addressing these knowledge gaps will contribute significantly to our understanding of peroxisome biology and could lead to innovative applications in crop improvement and biotechnology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.