Recombinant Oryza sativa subsp. indica Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your own preparation.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
ycf4; 9311068; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
ycf4
Target Protein Sequence
MNWRSEHIWIELLKGSRKRGNFFWACILFLGSLGFLAVGASSYLGKNIISVLPSQQILFF PQGVVMSFYGIAGLFISAYLWCTILWNVGSGYDRFDRKEGVVCIFRWGFPGIKRRVFLRF LMRDIQSIRIQVKEGLFPRRILYMEIRGQGAIPLTRTDEKFFTPREIEQKAAELAYFLRI PMEVF
Uniprot No.

Target Background

Function
Appears essential for the assembly of the photosystem I complex.
Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Ycf4 and what role does it play in photosynthesis?

Ycf4 (hypothetical chloroplast reading frame no. 4) is a thylakoid membrane-associated protein encoded by the chloroplast genome. It functions primarily as a scaffold protein during photosystem I (PSI) assembly. Studies in Chlamydomonas indicate that Ycf4 stabilizes intermediate subcomplexes consisting of the PsaAB heterodimer and the stromal subunits PsaCDE, while also facilitating the addition of the PsaF subunit to this subcomplex . Pulse-chase protein labeling experiments have revealed that PSI polypeptides associated with the Ycf4-containing complex are newly synthesized and partially assembled as pigment-containing subcomplexes, further supporting Ycf4's role as an assembly factor .

How conserved is the ycf4 gene across plant species including rice?

Plant GroupYcf4 Protein SizeConservation LevelNotable Features
Most angiosperms184-185 aaHighStandard size and structure
Soybean, Lotus japonicus~200 aaModerateExpanded protein size
Lathyrus speciesUp to 340 aaVery lowExtreme size expansion
Some legumes (Pisum sativum, some Desmodium)N/ANoneGene loss from chloroplast
Oryza sativa (inferred)~184-185 aaHigh (presumed)Likely maintains standard structure

The evolutionary rate of ycf4 is remarkably accelerated in some legume lineages, with greater sequence divergence within the single genus Lathyrus than between cyanobacteria and other angiosperms . For instance, Ycf4 protein identity between Lathyrus palustris and L. cirrhosus is only 31%, compared to 45% identity between tobacco and the cyanobacterium Synechocystis .

What are the standard methods for isolation and purification of recombinant Ycf4?

Recombinant Ycf4 can be isolated using affinity tag systems, with the tandem affinity purification (TAP) method being particularly effective. Based on Chlamydomonas studies, a successful purification protocol includes:

  • Fusion of a TAP-tag to the C-terminus of Ycf4 (avoiding N-terminal tagging which may interfere with thylakoid integration)

  • Solubilization of thylakoid membranes using n-dodecyl-β-D-maltoside (DDM)

  • Two-step affinity chromatography:

    • First column: IgG agarose binding (overnight incubation at 4°C for optimal binding)

    • TEV protease cleavage of the Protein A domain

    • Second column: Calmodulin resin binding in the presence of calcium ions

    • Elution with EGTA

This method has successfully purified the Ycf4 complex from Chlamydomonas while preserving its structural integrity and associated components .

What is known about the Ycf4-containing complex in rice compared to other model organisms?

While specific information about the Oryza sativa Ycf4 complex is limited in the search results, comparative analysis with the well-studied Chlamydomonas system provides valuable insights for rice researchers.

In Chlamydomonas, Ycf4 exists in a large complex exceeding 1500 kD that includes the opsin-related protein COP2 and several PSI subunits, including PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF . Electron microscopy analysis revealed that the largest structures in purified preparations measure approximately 285 × 185 Å, suggesting several large oligomeric states .

OrganismComplex SizeKnown ComponentsStructural Features
Chlamydomonas>1500 kDYcf4, COP2, PsaA, PsaB, PsaC, PsaD, PsaE, PsaF285 × 185 Å particles
TobaccoNot specifiedMembrane-associatedFunctional without being essential
Rice (inferred)UnknownPresumed similar to other higher plantsRequires characterization

Rice researchers should investigate whether the Oryza sativa Ycf4 complex more closely resembles that of Chlamydomonas or other higher plants like tobacco, particularly regarding complex size, component composition, and salt sensitivity of interactions.

How does the dependency on Ycf4 for PSI assembly differ between rice and other photosynthetic organisms?

The requirement for Ycf4 in PSI assembly varies significantly across photosynthetic organisms, representing an evolutionary divergence in photosynthetic mechanisms:

  • Chlamydomonas reinhardtii: Ycf4 is absolutely essential for PSI assembly and photoautotrophic growth .

  • Cyanobacteria: Ycf4-deficient mutants can still assemble PSI complexes, albeit at reduced levels .

  • Higher plants (tobacco): Ycf4 knockout mutants can grow photoautotrophically under low light conditions, though with severely retarded growth and development. These plants eventually reach the reproductive stage and set flowers .

This gradient of dependency suggests an evolutionary shift in the PSI assembly pathway. For rice researchers, determining where Oryza sativa falls on this spectrum is crucial. Based on its evolutionary position as a higher plant, rice likely resembles tobacco in having alternative pathways for PSI assembly that function in the absence of Ycf4, though with reduced efficiency.

What experimental approaches can distinguish between direct and indirect roles of Ycf4 in PSI assembly?

To differentiate between direct and indirect roles of Ycf4 in PSI assembly, researchers can employ the following experimental approaches:

  • Protein-Protein Interaction Analysis:

    • Co-immunoprecipitation with anti-Ycf4 antibodies followed by mass spectrometry

    • Yeast two-hybrid screening with rice Ycf4 as bait

    • Bimolecular fluorescence complementation (BiFC) to visualize interactions in vivo

  • Time-resolved Assembly Studies:

    • Pulse-chase labeling of chloroplast proteins to track the kinetics of PSI subunit incorporation

    • Synchronized induction of Ycf4 expression in conditional mutants

    • Time-course sampling during chloroplast development

  • Structural Analysis:

    • Cryo-electron microscopy of purified Ycf4 complexes

    • Cross-linking coupled with mass spectrometry to map interaction interfaces

    • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

  • Mutational Analysis:

    • Site-directed mutagenesis of conserved Ycf4 domains

    • Domain swapping between rice and Chlamydomonas Ycf4

    • Creation of chimeric Ycf4 proteins to identify functional domains

Results from these approaches would help establish whether Ycf4 directly contacts PSI subunits during assembly or whether it primarily acts through other factors in an indirect manner.

What are the optimal conditions for expressing recombinant Oryza sativa Ycf4?

Expressing recombinant Oryza sativa Ycf4 presents challenges due to its membrane-associated nature and involvement in multi-protein complexes. Based on experimental approaches with other Ycf4 proteins, researchers should consider the following optimized protocol:

Expression System Selection:

SystemAdvantagesDisadvantagesRecommendations
E. coliRapid growth, high yieldLacks chloroplast-specific chaperonesUse for initial structural studies
Chloroplast transformationNative environmentTechnically challengingBest for functional studies
ChlamydomonasSimilar photosynthetic machineryDifferent from plant systemGood compromise model
Plant cell cultureMore native-likeLower yieldsUse for verification

Optimization Parameters:

  • Vector design: Include chloroplast transit peptide for proper targeting in eukaryotic systems

  • Affinity tags: C-terminal tags preferable to avoid interference with membrane insertion

  • Induction conditions: Lower temperatures (16-18°C) for E. coli expression to improve folding

  • Solubilization: n-dodecyl-β-D-maltoside (DDM) at 1-2% for membrane extraction

  • Co-expression: Consider co-expressing interaction partners like COP2 for stability

When expressing in E. coli, codon optimization for rice-specific codons can significantly improve expression levels.

How can researchers generate and verify ycf4 knockout mutants in rice?

Generating ycf4 knockout mutants in rice requires specialized approaches due to the chloroplast location of the gene. The following methodology is recommended:

Generation of ycf4 Knockouts:

  • Chloroplast transformation:

    • Design a construct replacing ycf4 with a selectable marker gene (e.g., aadA conferring spectinomycin resistance)

    • Include flanking sequences (≥1 kb) homologous to regions surrounding ycf4

    • Deliver DNA via biolistic bombardment of embryogenic rice callus

    • Select transformants on spectinomycin-containing medium

  • Verification of homoplasmy:

    • Southern blot analysis with ycf4-specific and marker gene-specific probes

    • PCR analysis of wild-type and transformed genomes

    • Northern blot to confirm absence of ycf4 transcripts

    • Western blot using specific anti-Ycf4 antibodies

    • Seed germination assays on selective medium to confirm maternal inheritance and lack of segregation

  • Phenotypic characterization:

    • Growth comparison under varying light intensities (critical as tobacco Δycf4 plants cannot grow above 80 μE m⁻² s⁻¹)

    • Photosynthetic parameter measurements

    • Comparative analysis with wild-type and PSI-deficient control plants

Based on tobacco studies, researchers should expect rice ycf4 knockouts to exhibit extremely retarded growth under low light conditions while being unable to survive under normal or high light intensities .

What methods are most effective for analyzing Ycf4 interaction with PSI components?

To analyze Ycf4 interactions with PSI components in rice, researchers should employ multiple complementary approaches:

  • Biochemical Approaches:

    • Tandem affinity purification of tagged Ycf4

    • Sucrose gradient ultracentrifugation followed by ion exchange chromatography

    • Blue native PAGE to separate intact complexes

    • Co-immunoprecipitation with antibodies against Ycf4 or PSI subunits

    • Chemical cross-linking coupled with mass spectrometry

  • Biophysical Methods:

    • Surface plasmon resonance to measure binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

    • Fluorescence resonance energy transfer (FRET) for protein proximity

    • Single-particle electron microscopy of purified complexes

  • In vivo Approaches:

    • Split-GFP complementation assays

    • Proximity labeling techniques (BioID, APEX)

    • Conditional expression systems to monitor assembly dynamics

These methods can reveal both stable and transient interactions between Ycf4 and PSI components, providing insights into the assembly mechanism in rice.

How do researchers reconcile conflicting data about Ycf4 essentiality across species?

The varying dependency on Ycf4 across photosynthetic organisms presents an intriguing evolutionary puzzle. To reconcile these differences, researchers should consider:

  • Evolutionary Compensation Hypothesis:

    • Higher plants may have evolved redundant assembly factors lacking in Chlamydomonas

    • Comparative genomics approaches to identify candidate compensatory proteins

    • Testing whether overexpression of these candidates in Chlamydomonas ycf4 mutants rescues the phenotype

  • Structural Adaptation Model:

    • PSI complexes in different organisms may have evolved differing structural requirements

    • Comparative structural analysis of PSI from Chlamydomonas, cyanobacteria, and higher plants

    • Examining whether PSI subunit interfaces differ in ways that affect assembly dependencies

  • Methodological Approach:

    • Analysis under varying environmental conditions (light intensity, temperature, nutrient availability)

    • Quantitative rather than qualitative assessment of PSI assembly rates

    • Development of more sensitive metrics for PSI functionality

A working model that integrates available data would suggest that while the core function of Ycf4 in PSI assembly is conserved, higher plants have evolved partial redundancy in the assembly pathway, perhaps through duplication and diversification of assembly factors or through structural modifications to PSI components that reduce dependency on specific chaperones.

What explains the accelerated evolution of ycf4 in some plant lineages but not others?

The dramatic acceleration of ycf4 evolution in legumes but not in other plant lineages represents an evolutionary enigma. Based on the search results, several hypotheses warrant investigation:

  • Localized Hypermutation:
    Research in legumes has identified a 1.5 kb hypermutable region coinciding with the ycf4 gene, where the point mutation rate is at least 20 times higher than elsewhere in the chloroplast genome . This localized hypermutation appears to drive both accelerated sequence evolution and gene loss.

  • Mutational Mechanisms:
    The underlying mechanism may involve "repeated DNA breakage and repair" in this specific region . For rice researchers, examining whether similar hypermutation occurs in any regions of the Oryza chloroplast genome could reveal evolutionary patterns.

  • Functional Implications:
    Despite extreme sequence divergence, ycf4 appears to remain functional in many legume species, suggesting substantial structural flexibility in the protein . This contrasts with many other chloroplast-encoded proteins that show high conservation.

  • Gene Loss Patterns:
    The ycf4 gene has been lost entirely from the chloroplast genome in multiple independent legume lineages, including Lathyrus odoratus and three other legume groups . Researchers should investigate whether the gene has relocated to the nuclear genome or if its function has been supplanted by another protein.

Plant GroupEvolutionary RateProtein SizeGene Status
Most angiospermsSlow184-185 aaConserved in chloroplast
Some legumesExtremely accelerated200-340 aaPresent but highly divergent
Other legumesN/AN/ALost from chloroplast
Rice and cerealsPresumed slowPresumed 184-185 aaConserved in chloroplast

This pattern suggests that studying intermediate evolutionary stages could provide insights into both functional constraints and evolutionary mechanisms.

What technical challenges confound functional characterization of Ycf4 in rice?

Researchers investigating Oryza sativa Ycf4 face several technical challenges that may complicate functional characterization:

  • Chloroplast Transformation Efficiency:

    • Rice chloroplast transformation remains technically challenging compared to tobacco

    • Lower transformation frequencies require screening larger numbers of putative transformants

    • Strategies: Optimize bombardment parameters and use strong positive selection

  • Tissue Culture Limitations:

    • Rice regeneration from transformed callus can be genotype-dependent

    • Strategies: Select highly regenerable cultivars; optimize hormone concentrations

  • Homoplasmy Achievement:

    • Achieving homoplasmic state (complete replacement of wild-type chloroplast genomes) is essential

    • Multiple rounds of selection on increasing antibiotic concentrations may be required

    • Verification requires multiple complementary approaches

  • Phenotypic Analysis Complexities:

    • Light-sensitivity of ycf4 mutants requires carefully controlled growth conditions

    • Distinguishing primary effects from secondary consequences of impaired photosynthesis

    • Strategies: Include appropriate controls (e.g., PSI-deficient plants with known mutations)

  • Biochemical Purification Challenges:

    • Maintaining intact Ycf4 complexes during purification

    • Developing rice-specific antibodies for immunoprecipitation

    • Strategies: Adapt established protocols from Chlamydomonas studies

These challenges necessitate careful experimental design and the development of rice-specific protocols rather than direct application of methods optimized for model systems.

How might structural biology approaches enhance our understanding of rice Ycf4?

Advanced structural biology techniques can significantly expand our understanding of Oryza sativa Ycf4 function and interactions:

  • Cryo-Electron Microscopy:

    • Single-particle analysis of purified Ycf4 complexes could reveal the architecture of assembly intermediates

    • Comparative structural analysis with Chlamydomonas Ycf4 complexes (known to measure 285 × 185 Å)

    • Time-resolved structural studies during PSI assembly

  • Integrative Structural Biology:

    • Combining X-ray crystallography of individual domains with cryo-EM of intact complexes

    • Molecular dynamics simulations to understand conformational flexibility

    • Cross-linking mass spectrometry to map protein-protein interfaces

  • In situ Structural Biology:

    • Cryo-electron tomography of chloroplast membranes to visualize Ycf4 in its native environment

    • Correlative light and electron microscopy to localize Ycf4 complexes

    • Expansion microscopy for super-resolution imaging of assembly intermediates

These approaches could resolve several outstanding questions:

  • How does the rice Ycf4 complex architecture compare with that of Chlamydomonas?

  • What structural changes occur during PSI assembly?

  • How do Ycf4-PSI interactions differ between organisms with different dependencies on Ycf4?

What omics approaches would provide comprehensive insights into Ycf4 function?

Integrative omics approaches can provide system-level insights into rice Ycf4 function:

  • Comparative Proteomics:

    • Quantitative comparison of thylakoid membrane proteomes between wild-type and ycf4 mutant rice

    • Pulse-chase proteomics to track protein assembly kinetics

    • Protein correlation profiling across sucrose gradient fractions

  • Structural Proteomics:

    • Hydrogen-deuterium exchange mass spectrometry to map dynamic regions

    • Limited proteolysis coupled with mass spectrometry to identify domain boundaries

    • Cross-linking mass spectrometry to identify interaction interfaces

  • Transcriptomics:

    • RNA-seq analysis of nuclear gene expression changes in ycf4 mutants

    • Chloroplast transcriptome analysis to identify compensatory responses

    • Ribosome profiling to assess translational responses

  • Metabolomics:

    • Targeted analysis of photosynthetic metabolites

    • Untargeted metabolomics to identify broader metabolic adaptations

    • Stable isotope labeling to track carbon flux

  • Integrative Multi-omics:

    • Network analysis to identify functional relationships

    • Machine learning approaches to predict PSI assembly mechanisms

    • Comparative analysis across species with different Ycf4 dependencies

These approaches would help identify both direct partners and downstream effects of Ycf4 disruption, providing a comprehensive understanding of its role in rice.

How can CRISPR technologies advance Ycf4 research in rice?

While CRISPR/Cas9 cannot directly edit the chloroplast genome due to challenges in delivering Cas9 to chloroplasts, several CRISPR-based approaches can still advance Ycf4 research:

  • Nuclear-encoded Factors:

    • Target nuclear genes encoding proteins that interact with Ycf4

    • Create conditional mutants of nuclear factors involved in PSI assembly

    • Engineer nuclear-encoded synthetic proteins that complement or modify Ycf4 function

  • Transplastomic CRISPR Systems:

    • Develop chloroplast-targeted CRISPR systems for future direct editing

    • Express plastid-targeted RNA-guided nucleases from the nuclear genome

    • Explore alternative nucleases with better chloroplast delivery potential

  • Base Editing Applications:

    • Create point mutations in nuclear genes that modify chloroplast import or assembly pathways

    • Develop chloroplast-targeted base editors for future applications

    • Engineer regulatory elements affecting chloroplast gene expression

  • Diagnostic Applications:

    • CRISPR-based imaging of assembly factors using dCas9-fluorescent protein fusions

    • RNA targeting (via Cas13) to modulate chloroplast transcripts

    • Proximity labeling using dCas9-APEX2 fusions to identify interaction partners

These approaches would circumvent the current limitations in directly applying CRISPR to chloroplast genomes while still leveraging the precision and versatility of CRISPR technologies for advancing Ycf4 research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.