Recombinant Oryza sativa subsp. indica Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Overview and Molecular Characterization

Recombinant Oryza sativa subsp. indica Photosystem II CP47 Chlorophyll Apoprotein (psbB) is a full-length, His-tagged protein expressed in E. coli for biochemical and structural studies. This protein is a critical component of Photosystem II (PSII), serving as a chlorophyll-binding antenna complex that facilitates light energy absorption and transfer during photosynthesis .

Key Molecular Features

PropertyDetails
SpeciesOryza sativa (Rice)
UniProt IDP0C362
Expression SystemE. coli
TagN-terminal His tag
Length508 amino acids (Full-length: 1–508 aa)
Purity>90% (SDS-PAGE verified)
StorageLyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0)

The protein sequence begins with MGLPWYRVHTVVLNDPGRLLSVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM..., containing five conserved histidine pairs critical for chlorophyll binding .

Role in Photosystem II Assembly

CP47 (encoded by psbB) is a core PSII component that stabilizes the reaction center and coordinates chlorophyll molecules. Studies in cyanobacteria and rice mutants reveal:

  • CP47 forms a scaffold for chlorophyll clusters, with hydrophobic regions anchoring pigments .

  • Loss of psbB disrupts PSII assembly, confirming its necessity for functional photosynthesis .

Interactions with Auxiliary Proteins

  • PAP90: A nuclear-encoded protein in rice stabilizes D1 (a PSII reaction center protein) and interacts with CP47 to maintain PSII integrity .

  • FPB1: Cooperates with PAM68 to regulate CP47 synthesis; fpb1 mutants show impaired pre-CP47 complex formation .

Research Use Cases

  • Photosynthesis Studies: Recombinant CP47 enables in vitro analysis of chlorophyll-protein interactions and PSII repair mechanisms .

  • Stress Response Models: OsLHCB3 knockdown mutants (linked to CP47 function) exhibit reduced chlorophyll content and photoinhibition tolerance, highlighting CP47’s role in stress adaptation .

Evolutionary and Ecological Significance

Comparative genomics of 22 Oryza species reveals:

  • Positive Selection: psbB is under adaptive evolution in sun-loving rice species, optimizing light capture in high-irradiance environments .

  • Repeat Dynamics: Chloroplast genome expansions in Oryza correlate with increased repeat density near psbB, suggesting evolutionary tuning of PSII efficiency .

COG Classification

COG IDFunctionOrganismsMedian Length
5717PSII reaction center chlorophyll-binding70/2296511.79 aa
(Source: NCBI COG database)

Mutant Phenotypes

  • CP47 Synthesis Defects: fpb1 mutants accumulate PSII monomers but lack mature CP47 complexes, stalling PSII assembly .

  • Chlorophyll Binding: OsLHCB3 RNAi lines show pale leaves and reduced NPQ capacity, indirectly implicating CP47 in energy dissipation .

Future Directions

Recombinant CP47 is pivotal for:

  • Structural Biology: Cryo-EM studies to resolve chlorophyll arrangement in PSII.

  • Crop Engineering: Enhancing PSII stability in rice under abiotic stress via psbB overexpression or editing .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery time information.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize developing it according to your request.
Synonyms
psbB; 9311089; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSISGGTVTNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLAGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQA VNPVWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSDGLAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDEEGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRSQLGEIFELDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGTFQKVGDPTTRRQPV
Uniprot No.

Target Background

Function
Photosystem II CP47 chlorophyll apoprotein (psbB) is a component of the photosystem II (PSII) core complex in *Oryza sativa subsp. indica*. It binds chlorophyll and contributes to catalyzing the primary light-induced photochemical processes of PSII. PSII is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient. This gradient is subsequently used for ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the role of psbB in Photosystem II of Oryza sativa?

The psbB gene encodes the CP47 chlorophyll apoprotein, which functions as an integral antenna in Photosystem II (PSII). In Oryza sativa, as in other photosynthetic organisms, CP47 plays a critical role in harvesting light energy and facilitating efficient excitation energy transfer to the PSII reaction center. This energy transfer eventually leads to charge separation that initiates the electron transfer cascade driving oxygenic photosynthesis . CP47 contains 16 chlorophyll molecules whose spatial arrangement and electronic properties are essential for its light-harvesting function. The protein's structure creates specific microenvironments that tune the excitation energies of these chlorophylls, allowing them to funnel energy toward the reaction center in a directed manner.

How is the expression of psbB regulated in the chloroplast?

The expression of psbB in the chloroplast is regulated at multiple levels, particularly at the translation initiation stage. Unlike typical bacterial systems, chloroplast translation is not solely dependent on Shine-Dalgarno sequences upstream of the start codon. The 5' untranslated region (5'UTR) of psbB plays a major role in translation initiation and regulation . Specific secondary structure folding in the 5'UTR can influence the accessibility of ribosomes to the translation start site. Additionally, gene expression in the chloroplast is controlled by nuclear-encoded pentatricopeptide repeat (PPR) proteins that bind to specific RNA sequences . These regulatory mechanisms ensure appropriate expression levels of psbB in response to developmental and environmental cues.

What are the structural characteristics of the CP47 protein that make it essential for PSII function?

CP47 serves as a core antenna protein in PSII with several structural features that enable its function:

  • Chlorophyll binding sites: CP47 binds 16 chlorophyll molecules in specific orientations that facilitate efficient energy transfer.

  • Protein scaffold: The protein creates distinct electrostatic environments around each chlorophyll, tuning their excitation energies.

  • Transmembrane helices: These anchor the protein in the thylakoid membrane and position the chlorophylls optimally.

  • Interaction surfaces: CP47 forms specific contacts with other PSII components, ensuring proper assembly of the complete photosystem.

What computational approaches are most effective for studying chlorophyll excitation energies in CP47?

For investigating chlorophyll excitation energies in CP47, multiscale quantum mechanics/molecular mechanics (QM/MM) approaches have proven highly effective. Current state-of-the-art methodology employs full time-dependent density functional theory with modern range-separated functionals to compute the excitation energies of all CP47 chlorophylls . This approach allows researchers to quantify the electrostatic effect of the protein environment on the site energies of CP47 chlorophylls.

The computational workflow typically involves:

  • Creating a complete computational model of "near-native" cyanobacterial PSII, including membrane embedding

  • Identifying all chlorophyll molecules within CP47

  • Performing QM/MM calculations on each chlorophyll in its protein environment

  • Analyzing the distribution of calculated site energies

  • Identifying the most red-shifted chlorophylls (typically B3, followed by B1)

This methodology provides a high-level quantum chemical excitation profile of CP47, which can differ from previous hypotheses in the literature and offer alternative interpretations of experimental spectroscopic data .

How can researchers effectively clone and express recombinant psbB from Oryza sativa for functional studies?

Cloning and expressing chloroplast-encoded proteins like psbB requires specialized approaches. A methodological workflow includes:

  • DNA isolation: Extract total DNA from Oryza sativa subsp. indica leaf tissue using CTAB-based methods.

  • Gene amplification: Design primers specific to the psbB coding sequence, accounting for possible chloroplast genome variations.

  • Vector selection: Use a chloroplast-compatible expression vector system that includes appropriate regulatory elements.

  • Transformation approach: For chloroplast-encoded proteins, consider both in vitro translation systems and transplastomic approaches.

  • Expression verification: Employ western blotting with specific antibodies against CP47 to confirm successful expression.

For heterologous expression, the Phytobrick Entry Vector with GFP dropout (BBa_K2560002) has been successfully used for chloroplast protein expression . This system is compatible with the Phytobrick assembly standard, which facilitates modular cloning approaches.

What experimental systems can be used to study the function of recombinant psbB in isolation from the native PSII complex?

Several experimental systems can be employed to study recombinant psbB outside its native context:

Experimental SystemAdvantagesLimitationsKey Applications
Chloroplast cell-free systems (ccfs)Maintains chloroplast-specific factors, rapid assessmentLimited post-translational modificationsTranslation efficiency, protein folding
Reconstituted proteoliposomesMembrane environment, controlled compositionComplex preparation, potential aggregationEnergy transfer, protein-protein interactions
E. coli-based expressionHigh yield, ease of genetic manipulationLacks chloroplast-specific factorsStructural studies, antibody production
Transplastomic tobaccoComplete chloroplast environmentTime-consuming, species differencesIn vivo function, mutagenesis studies

Chloroplast cell-free systems derived from the same or related plant species have been successfully used to characterize chloroplast parts, leveraging the conservation of regulatory sequences across species . This approach allows for the screening of part activity while minimizing unwanted recombination events that might occur in vivo.

How can researchers interpret spectroscopic data to understand energy transfer in recombinant CP47?

Interpreting spectroscopic data for CP47 requires correlating experimental measurements with structural information. A methodological approach includes:

When analyzing the data, researchers should consider that the ranking of site energies and the identity of the most red-shifted chlorophylls (typically B3, followed by B1) may differ from previous literature hypotheses . Additionally, data from isolated CP47 should be interpreted cautiously, as molecular dynamics simulations have shown that certain regions of the protein may exhibit different structural properties when extracted from the complete PSII complex .

What approaches can be used to analyze the effects of point mutations in recombinant psbB on its function?

Analysis of point mutations in psbB requires a systematic approach:

  • Structural mapping: Identify residues likely to affect chlorophyll binding or protein stability based on structural data.

  • Site-directed mutagenesis: Create specific amino acid substitutions in the recombinant psbB gene.

  • Functional characterization: Assess the impact on:

    • Protein folding and stability

    • Chlorophyll binding efficiency

    • Excitation energy transfer rates

    • Integration into PSII complexes

  • Computational validation: Use QM/MM approaches to predict the impact of mutations on chlorophyll excitation energies.

A comparative analysis of wild-type and mutant proteins using time-resolved spectroscopy can reveal changes in energy transfer pathways. Additionally, thermal stability assays can identify mutations that affect protein stability, which may indirectly impact function by altering the microenvironment of chlorophyll molecules.

What are the common challenges in expressing recombinant psbB and how can they be overcome?

Researchers frequently encounter several challenges when working with recombinant psbB:

ChallengePotential SolutionsImplementation Notes
Low expression levelsOptimize codon usage for the expression systemConsider chloroplast-specific codon preferences
Protein misfoldingInclude chlorophyll precursors in the expression mediumMonitor proper pigment incorporation spectroscopically
AggregationUse detergents or lipid nanodiscs for membrane protein stabilizationTest multiple detergent types for optimal solubilization
Lack of cofactor incorporationCo-express chlorophyll synthesis genesVerify chlorophyll binding through absorbance ratios
Proteolytic degradationInclude protease inhibitors during extractionOptimize temperature and pH during purification

Additionally, unwanted recombination events can impede the successful functionality of genetic designs targeting the chloroplast. To combat this, researchers can create a variety of different genetic parts with sufficient sequence diversity while maintaining functional conservation .

How can researchers optimize energy transfer measurements in recombinant CP47 proteins?

Optimizing energy transfer measurements for recombinant CP47 requires careful consideration of experimental conditions:

  • Sample preparation:

    • Ensure complete incorporation of chlorophyll molecules

    • Maintain protein in a native-like lipid environment

    • Control protein-to-pigment ratios precisely

  • Instrument setup:

    • Use appropriate excitation wavelengths that target specific chlorophylls

    • Select detection wavelengths that capture the full emission spectrum

    • Employ time-resolved techniques with sufficient temporal resolution

  • Data analysis:

    • Apply global analysis methods to extract transfer rates

    • Use target analysis to test specific energy transfer models

    • Compare experimental results with QM/MM predictions

  • Controls and validations:

    • Compare with native CP47 isolated from Oryza sativa

    • Use site-directed mutants as reference points

    • Validate findings across multiple independent preparations

Researchers should be aware that extracted CP47 samples may exhibit different properties than those in the complete PSII complex. Molecular dynamics simulations can help identify which parts of the protein structure might be affected when isolated from its native context .

How does the psbB sequence and function in Oryza sativa compare to other plant species?

The psbB gene encoding CP47 is highly conserved across photosynthetic organisms due to its essential role in PSII function. Comparative analysis reveals:

  • Sequence conservation: The coding regions of psbB show high conservation, particularly in chlorophyll-binding domains.

  • Regulatory differences: The 5'UTR regions may show greater variation, reflecting species-specific regulatory mechanisms.

  • Functional conservation: Plastid parts, including psbB regulatory elements, often maintain functionality across species boundaries .

This conservation allows for cross-species utilization of regulatory sequences in synthetic biology applications. For example, the 5'UTR of psbB from one species can often drive gene expression when transferred to the chloroplast of another species . This knowledge is particularly valuable for designing expression systems that can function across different plant species.

What insights can be gained from studying psbB in the context of rice stress responses?

While psbB itself is not directly involved in stress response pathways, photosynthetic efficiency under stress conditions can be influenced by the function of PSII components. Research has shown that:

  • Salt stress affects PSII efficiency in rice, potentially through alterations in protein-pigment interactions.

  • Transgenic approaches targeting other components of chloroplast metabolism can enhance salt tolerance in rice .

  • Modifications to energy transfer efficiency might contribute to stress resilience.

For instance, transgenic rice plants overexpressing certain metabolism-related genes have shown enhanced germination rates and seedling growth under salt stress conditions . These findings suggest that optimizing photosynthetic efficiency through modifications to components like CP47 could potentially contribute to stress tolerance strategies in crop improvement programs.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.