Recombinant Oryza sativa subsp. indica Photosystem II D2 protein (psbD)

Shipped with Ice Packs
In Stock

Description

3.1. PSII Assembly and Stability

  • The D2 protein interacts with auxiliary factors (e.g., PAP90) to stabilize D1, ensuring PSII complex integrity .

  • Mutations in psbD disrupt thylakoid membrane organization, reducing PSII efficiency and chlorophyll accumulation .

3.2. Stress Response Mechanisms

  • Oxidative Stress: Instability of D1/D2 proteins increases reactive oxygen species (ROS), triggering antioxidant enzyme activity .

  • Thermal/UV Adaptation: Differential expression of psbD isoforms under high light or UV-B exposure modulates PSII repair .

4.1. Biochemical Studies

  • ELISA Kits: Commercial assays (e.g., CSB-CF315006OFF) enable quantitative analysis of psbD in rice tissues .

  • Mutagenesis: Chimeric D2 proteins with modified loops retain functionality, highlighting structural resilience .

4.2. Transcriptomic Insights

  • Knockdown of PSII-associated genes (e.g., OsLHCB3) reduces chlorophyll binding and PSII-related gene expression, validated via RNA-seq .

Comparative Analysis of psbD Homologs

Table 3: Functional Conservation Across Species

SpeciespsbD RoleReference Model
Oryza sativaStabilizes D1; regulates ROS under stress
Arabidopsis thalianaInteracts with HCF243 for D1 stability
Synechocystis sp.Tolerates loop modifications without functional loss

Future Directions

  • Structural Biology: Cryo-EM studies to resolve psbD-D1 interactions in rice.

  • Agricultural Biotechnology: Engineering psbD variants for stress-tolerant rice cultivars.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will prepare your order accordingly.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery information.
Note: All protein shipments are sent with standard blue ice packs. If dry ice is required, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, briefly centrifuge the vial to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a preferred tag type, please inform us and we will prioritize development of the specified tag.
Synonyms
psbD; 9311016; Photosystem II D2 protein; PSII D2 protein; Photosystem Q(A protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
psbD
Target Protein Sequence
MTIALGRVTKEENDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FALIGFMLRQFELARSVQLRPYNAISFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H₂O. This process generates O₂ and a proton gradient, which is subsequently used for ATP formation. It consists of a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors. D2 is essential for the assembly of a stable PSII complex.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the significance of D2 protein (PsbD) in photosystem II assembly?

The D2 protein represents the starting point for the assembly of photosystem II (PSII) as a whole. According to the Control by Epistasis of Synthesis (CES) model for the temporal sequence of PSII assembly, the amount of D2 available directly determines the levels of other component subunits of PSII via feedback control mechanisms. This makes D2 synthesis a rate-limiting step in PSII formation and function .

Research approaches to study this relationship typically involve monitoring D2 levels in relation to other PSII components using protein gel blot analysis and pulse labeling experiments after inhibiting cytoplasmic translation with cycloheximide. These techniques allow researchers to differentiate between effects on protein synthesis versus protein stability .

How do RNA stability factors influence D2 protein expression in rice?

The expression of the psbD gene encoding the D2 subunit is regulated by specific RNA stability factors. In Chlamydomonas (a model organism with conserved mechanisms), Nac2, a 140-kD tetratricopeptide repeat protein, is strictly required for the stabilization of the psbD mRNA via its 5′UTR. Additionally, a second factor, RBP40, binds to a U-rich translational element located 15 nucleotides upstream of the AUG start codon .

Methodologically, researchers can investigate these interactions through:

  • RNA interference (RNAi) lines targeting RNA stability factors

  • Analysis of steady-state mRNA levels versus protein synthesis rates

  • Protein-RNA binding assays to identify regulatory elements

Studies have shown that reduction in RBP40 levels correlates directly with decreased D2 synthesis rates, without significantly changing psbD mRNA concentrations, indicating that RBP40 affects translation rather than transcription or mRNA stability .

What are the recommended growth conditions for studying recombinant D2 protein in rice?

When studying D2 protein in rice, precise growth conditions are essential for reproducible results. Based on established protocols, researchers should consider:

  • Temperature control: Maintain day/night temperatures of 30°C/24°C

  • Humidity: Approximately 70% air humidity

  • Light conditions: Minimum photosynthetic photon-flux density of 396 μmol m⁻² s⁻¹ (PAR)

  • Growth medium: For hydroponic experiments, use modified Yoshida solution with pH adjusted to 6.0

  • Growth stages: Monitor development using standardized growth stage scales (e.g., BBCH scale, where BBCH 14 represents four leaves unfolded and BBCH 16 represents six leaves unfolded)

These conditions have been validated for rice growth in controlled environments and allow for standardized experimental setups when studying photosynthetic proteins.

How can researchers differentiate between effects on D2 protein synthesis versus stability?

To distinguish between effects on D2 protein synthesis versus stability, researchers typically employ pulse labeling experiments after inhibiting cytoplasmic translation. This methodological approach involves:

  • Treating cells with cycloheximide to inhibit cytoplasmic translation

  • Adding radioactive amino acids to label newly synthesized proteins

  • Collecting samples at different time points

  • Analyzing protein patterns through gel electrophoresis and autoradiography

  • Quantifying D2 protein bands to determine synthesis rates

This approach has revealed that factors like RBP40 primarily affect D2 synthesis rather than stability. For example, RNAi lines with reduced RBP40 show drastically reduced D2 synthesis rates that correlate with the levels of D2 accumulation revealed by protein gel blot analysis .

What molecular mechanisms regulate the translational control of psbD mRNA in Oryza sativa compared to model organisms?

The translational regulation of psbD mRNA in rice shares similarities with model organisms like Chlamydomonas but exhibits species-specific differences. In Chlamydomonas, RBP40 functions by inducing conformational changes within the RNA region encompassing the AUG start codon, thereby regulating early steps in translation initiation on the psbD message .

For rice-specific studies, researchers should:

  • Identify rice homologs of known regulatory factors (Nac2, RBP40) through comparative genomics

  • Perform RNA-protein interaction studies using rice-specific factors

  • Develop rice-specific RNAi or CRISPR/Cas9 lines targeting putative regulatory factors

  • Combine transcriptomic and proteomic approaches to correlate mRNA and protein levels

  • Use polysome profiling to directly measure translation efficiency of psbD mRNA

Recent research indicates that RBP40-like factors in rice may play similar roles, but with potential adaptations to the unique cellular environment of rice chloroplasts. Quantitative analysis through shotgun proteomics approaches can provide insights into these regulatory mechanisms .

How does phosphorus deficiency affect D2 protein accumulation and photosystem II assembly in different rice genotypes?

Phosphorus (P) deficiency significantly impacts photosynthetic machinery in rice, with genotype-specific responses. Studies comparing high P efficiency genotypes (e.g., DJ123) with low P efficiency genotypes (e.g., Nerica4) reveal differential impacts on photosystem components .

Methodological approach for studying P deficiency effects:

  • Grow rice in semi-hydroponic systems with controlled P levels (e.g., 1 μM for low P, 100 μM for adequate P)

  • Monitor physiological responses including root exudation patterns

  • Quantify photosynthetic proteins including D2 through immunoblotting

  • Measure photosystem II efficiency through chlorophyll fluorescence

  • Correlate protein abundance with photosynthetic performance

Research has shown that P deficiency alters root exudation patterns, which can indirectly affect nutrient acquisition and photosynthetic protein synthesis. Higher exudation rates were associated with lower biomass production, suggesting a trade-off between resource allocation for exudation versus growth .

What expression systems are most effective for producing functional recombinant D2 protein from Oryza sativa?

Multiple expression systems have been employed for recombinant photosynthetic proteins, each with advantages and limitations for D2 protein production:

Expression SystemAdvantagesLimitationsPurification Tags
E. coliHigh yield, rapid growth, economicalLack of post-translational modifications, inclusion body formationHis-tag, AviTag-Biotinylated
YeastEukaryotic processing, higher protein folding efficiencyLower yield than E. coli, longer production timeHis-tag
BaculovirusPost-translational modifications, higher molecular weight proteinsComplex system, higher costHis-tag, GST-tag
Mammalian cellNative-like protein folding and modificationsHighest cost, lowest yield, technically demandingHis-tag, Fc-fusion

For membrane proteins like D2, specialized approaches may be necessary:

  • Use of detergents or amphipols to maintain protein solubility

  • Co-expression with chaperones to facilitate proper folding

  • Development of cell-free systems for direct synthesis

The AviTag-BirA technology, where BirA catalyzes amide linkage between biotin and the specific lysine of the AviTag, has proven effective for biotinylation of recombinant proteins in vivo, potentially applicable to D2 protein .

How can advanced proteomics approaches be applied to study D2 protein dynamics during environmental stress?

Shotgun proteomics offers significant advantages for studying membrane proteins like D2 during stress conditions:

  • Direct analysis of peptides, which are easily fractionable

  • Detection of hydrophobic and low-abundant proteins

  • Simultaneous quantification of peptides from different samples

For D2 protein dynamics during environmental stress (e.g., salinity, temperature, light), a comprehensive experimental approach would include:

  • Time-course sampling (e.g., 6, 24, and 48 hours after stress application)

  • Comparative analysis between stress-tolerant and susceptible varieties

  • Parallel physiological measurements (photosynthetic efficiency, ion content)

  • Integration with transcriptomic data to assess transcriptional vs. post-transcriptional regulation

Studies on salinity-tolerant varieties like FL478 demonstrate the utility of this approach, as they reveal proteome-level adaptations that contribute to stress tolerance. Similar approaches can be applied specifically to study D2 protein dynamics under various environmental conditions .

What genetic factors influence D2 protein sequence variation and functional differences across rice subspecies?

Rice subspecies (indica, japonica, aus) exhibit genetic diversity that affects photosynthetic protein structure and function. Analysis of advanced breeding lines reveals:

  • Significant genetic variation in photosynthetic traits across genotypes

  • Heritability of traits related to photosynthetic efficiency

  • Potential for selective breeding to enhance photosystem II performance

Methodological approaches for investigating subspecies differences include:

  • Genomic sequence analysis of psbD across diverse rice germplasm

  • Structure-function analysis of D2 protein variants

  • Association genetics to correlate sequence polymorphisms with photosynthetic efficiency

  • Transgenic complementation studies to validate functional differences

Recent genetic evaluations of advanced breeding lines demonstrate significant differences among genotypes for multiple traits, suggesting potential variation in photosynthetic protein sequences and functions that could be exploited for crop improvement .

What are the key technical challenges in isolating functional D2 protein from rice chloroplasts?

Isolating functional D2 protein presents several technical challenges due to its:

  • Membrane-embedded nature, requiring specialized detergents

  • Tight association with other photosystem II components

  • Sensitivity to light-induced damage during purification

  • Requirement for specific lipid environments to maintain function

Successful isolation protocols typically involve:

  • Preparation of thylakoid membranes under dim green light

  • Solubilization using mild detergents (n-dodecyl-β-D-maltoside or digitonin)

  • Density gradient centrifugation to isolate intact photosystem II complexes

  • Size exclusion chromatography for further purification

  • Verification of intact D2 protein using specific antibodies

Researchers should monitor photosystem II activity throughout purification to ensure functional integrity of the isolated complexes containing D2 protein .

How can researchers effectively design RNA interference experiments to study D2 protein synthesis?

Based on successful RNAi approaches studying D2 protein synthesis factors, researchers should:

  • Design specific inverted repeat structures targeting regulatory factors (e.g., RBP40 homologs)

  • Clone these structures into appropriate vectors with selectable markers

  • Transform rice or model organisms using established protocols

  • Screen transformants for target gene silencing using both molecular markers and phenotypic screening

  • Characterize multiple independent lines with varying levels of silencing

The effectiveness of RNAi can be assessed through:

  • Molecular analysis: qRT-PCR to measure target transcript reduction

  • Protein analysis: Western blotting to quantify target protein levels

  • Physiological assays: Chlorophyll fluorescence to measure photosystem II activity

  • Protein synthesis assays: Pulse labeling to measure D2 synthesis rates

This approach has successfully demonstrated the role of RBP40 in D2 synthesis, where RNAi lines showed drastically reduced D2 synthesis rates correlating with reduced photosystem II activity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.