Recombinant Oryza sativa subsp. indica Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
psbA; 9311001; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-344
Protein Length
Full Length of Mature Protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
psbA
Target Protein Sequence
TAILERRESTSLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDID GIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLL GVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFN FNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient for ATP synthesis. PSII comprises a core antenna complex for photon capture and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, and several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Photosystem Q(B) protein and what is its role in rice photosynthesis?

The Photosystem Q(B) protein, also known as PSII D1 protein, is a crucial component of photosystem II in rice (Oryza sativa). This protein is encoded by the psbA gene and functions as an integral membrane protein that binds plastoquinone at the QB site .

The D1 protein plays a vital role in photosynthetic electron transport, forming part of the reaction center where water splitting occurs. Specifically, it participates in the transfer of electrons from the primary quinone electron acceptor (QA) to the secondary quinone acceptor (QB), which is essential for the light-dependent reactions of photosynthesis .

Structurally, the mature protein consists of 344 amino acids (positions 2-344) and contains several transmembrane domains that anchor it within the thylakoid membrane of chloroplasts .

How do expression systems for recombinant Photosystem Q(B) protein work?

Expression of recombinant Photosystem Q(B) protein can be achieved through several systems, with E. coli being one of the most commonly used for initial studies . The process typically involves:

  • Gene cloning: The psbA gene is isolated from Oryza sativa and inserted into an appropriate expression vector containing a His-tag sequence for later purification.

  • Transformation: The recombinant vector is introduced into competent E. coli cells.

  • Induction and expression: Bacterial cultures are grown to appropriate density, and protein expression is induced using specific compounds depending on the promoter system.

  • Protein extraction and purification: The expressed protein is purified using affinity chromatography, typically utilizing the His-tag for metal affinity purification .

Alternative expression systems include plant-based systems, which may be more appropriate for functional studies. These can involve ethanol-inducible systems in plants like Nicotiana benthamiana, where expression levels can reach up to 4.3 mg/g fresh biomass under optimized conditions .

How can researchers optimize purification protocols for functional recombinant Photosystem Q(B) protein?

Purification of functional recombinant Photosystem Q(B) protein presents several challenges due to its hydrophobic nature and complex folding. An optimized protocol should include:

  • Selection of detergents: Use of mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin during extraction to maintain protein structure while solubilizing membrane components.

  • Buffer optimization: Employing buffers containing glycerol (6% as used in commercial preparations) and trehalose as stabilizers .

  • Affinity purification: Utilizing His-tag affinity chromatography with carefully optimized imidazole gradients to reduce non-specific binding.

  • Size exclusion chromatography: As a polishing step to obtain highly pure protein and separate properly folded protein from aggregates.

  • Storage conditions: Store in Tris/PBS-based buffer with 6% trehalose at pH 8.0, and avoid repeated freeze-thaw cycles by aliquoting before storage at -20°C/-80°C .

Purification StageKey ParametersCritical Considerations
ExtractionDetergent type and concentrationBalance between solubilization efficiency and protein denaturation
Initial purificationAffinity resin selectionBinding capacity and specificity
PolishingChromatography methodResolution and maintenance of protein integrity
StorageBuffer composition, temperatureLong-term stability and activity retention

The final product should be assessed for both purity (>90% by SDS-PAGE) and functional activity through spectroscopic methods that evaluate electron transport capability .

What proteomic approaches are most effective for studying Photosystem Q(B) protein in rice under stress conditions?

Quantitative proteomic analysis provides valuable insights into how Photosystem Q(B) protein responds to environmental stresses in rice. Based on current research methodologies, the following approaches are particularly effective:

  • iTRAQ-based quantitative proteomics: This technique has been successfully used to identify proteins in rice shoots responding to salt stress, revealing that proteins primarily involved in photosynthetic pathways show significant differential expression .

  • Tandem mass tags (TMT)-based proteomic methods: This approach has been used to quantitatively screen differentially expressed proteins in rice plants with different ploidy levels, revealing significant changes in photosystem proteins including PSBB (a component of PSII) .

  • Comparative proteomic analysis with physiological assessments: Integrating proteomic data with physiological measurements provides a comprehensive understanding of stress responses .

The workflow typically involves:

  • Protein extraction from control and stressed plants

  • Protein digestion and labeling with isobaric tags

  • LC-MS/MS analysis

  • Bioinformatic analysis including pathway enrichment

These approaches have revealed that photosynthesis and metabolic pathways are highly significantly associated with proteomic alterations under various stresses, with multiple chloroplast proteins showing differential expression .

How does polyploidy affect expression and function of photosystem proteins in rice?

Polyploidy significantly impacts the expression and function of photosystem proteins in rice, with several key findings:

  • Upregulation of chloroplast proteins: Comparative proteomic analysis between diploid and triploid rice plants has shown that 13 chloroplast proteins, including several photosystem components, are upregulated in triploid plants .

  • Enhanced photosynthetic efficiency: The increased expression of photosystem proteins correlates with enhanced photosynthetic capacity in polyploid rice plants.

  • Specific protein changes: Five key proteins have been verified to show higher abundance in triploid compared to diploid rice:

    • ATP synthase subunit (ATPF)

    • Photosystem I P700 chlorophyll a apoprotein A1 (PSAA)

    • Photosystem I P700 chlorophyll a apoprotein A2 (PSAB)

    • Photosystem II CP47 protein (PSBB)

    • Ribulose bisphosphate carboxylase large chain (RBL)

These proteomic alterations likely account for the morphological and physiological diversifications observed between plants with different ploidy levels. The upregulation of these proteins suggests that triploid rice plants maintain their metabolic needs via enhanced photosynthesis and metabolic activities compared to diploid plants .

This information provides valuable insights for researchers working on genetic improvement of rice varieties, suggesting that manipulation of ploidy can be a strategy to enhance photosynthetic efficiency and potentially crop yield.

What experimental approaches can be used to study the electron transport function of recombinant Photosystem Q(B) protein?

Studying the electron transport function of recombinant Photosystem Q(B) protein requires specialized techniques that can assess its activity within the photosynthetic electron transport chain:

  • Chlorophyll fluorescence measurements: This non-invasive technique allows assessment of Photosystem II efficiency and electron transport rate. Parameters such as photochemical quenching provide information about the functionality of the Q(B) binding site .

  • Oxygen evolution measurements: Using Clark-type oxygen electrodes to measure the rate of oxygen production as a proxy for electron transport efficiency.

  • EPR (Electron Paramagnetic Resonance) spectroscopy: This technique can detect the formation of semiquinone radicals at the QB site, providing direct evidence of electron transport function.

  • FTIR (Fourier-Transform Infrared) difference spectroscopy: Used to detect conformational changes in the protein associated with electron transfer events.

  • Site-directed mutagenesis studies: Creating specific mutations in the recombinant protein to identify amino acid residues critical for QB binding and electron transport.

Research has shown that environmental factors such as potassium availability can significantly affect photosystem II photochemistry, including parameters like photochemical quenching and photosynthetic electron transport rate , which are directly related to the function of the Q(B) protein.

How can researchers integrate structural and functional analyses of Photosystem Q(B) protein for improved understanding of photosynthetic mechanisms?

An integrated approach combining structural and functional analyses provides comprehensive insights into the role of Photosystem Q(B) protein in photosynthetic mechanisms:

  • Cryo-EM structural analysis: High-resolution structural determination allows visualization of the protein's interaction with cofactors and other photosystem components. The techniques used for photosystem I from cyanobacteria (2.7 Å resolution) can be adapted for studying Photosystem Q(B) protein .

  • Molecular dynamics simulations: Based on structural data, these simulations can predict conformational changes during electron transport and quinone binding.

  • Structure-guided mutagenesis: Using structural information to design targeted mutations that can validate computational predictions and reveal structure-function relationships.

  • Spectroscopic correlation: Combining structural data with spectroscopic measurements (such as time-resolved fluorescence) to correlate structural features with functional outcomes.

  • Comparative analysis across species: Studying structural and functional differences between Photosystem Q(B) protein from different rice subspecies (indica vs. japonica) and other organisms to identify conserved functional domains.

A particularly valuable approach is examining how specific chlorophylls and low-energy states (LWC - long-wavelength chlorophylls) within the photosystem contribute to energy transfer and photoprotection mechanisms . This integrated approach has revealed that specific low-energy states associated with particular chlorophylls can be quenched by oxidized reaction centers (P700+), which varies between species and may be important during high-light conditions .

Such comprehensive analyses are crucial for developing strategies to enhance photosynthetic efficiency in crop plants like rice, potentially leading to improved agricultural productivity.

What are the most effective inducible expression systems for studying recombinant photosystem proteins in plants?

For studying recombinant photosystem proteins in plants, ethanol-inducible expression systems have proven particularly effective:

  • Ethanol-inducible viral RNA replicon system: This system allows for high-level, controlled expression of recombinant proteins in transgenic plants through a simple ethanol treatment. The system involves:

    • Integration of DNA proreplicons into the plant genome

    • Ethanol-induced release of viral RNA replicons

    • RNA amplification leading to high-level protein production

  • Double-inducible system design: To achieve tight control of expression, viral vectors can be deconstructed with replicon and cell-to-cell movement protein placed under separate inducible promoters .

This approach offers several advantages for photosystem protein research:

  • Negligible background expression

  • Very high induction ratios (over 0.5 × 10^4-fold)

  • High absolute protein expression levels (up to 4.3 mg/g fresh biomass)

  • Scalability for larger experiments

The timing of expression can be precisely monitored, with protein detection beginning approximately 2 days after induction and reaching peak levels 5-7 days post-induction . This temporal control is particularly valuable for studying the assembly and function of complex photosystem components.

How do environmental stresses affect the expression and turnover of Photosystem Q(B) protein in rice?

Environmental stresses significantly impact both the expression and turnover of Photosystem Q(B) protein in rice, with important implications for photosynthetic efficiency and plant productivity:

The rapid turnover of D1 protein (Photosystem Q(B) protein) is a known response to various stresses, particularly photodamage. This protein has one of the highest turnover rates among thylakoid membrane proteins, reflecting its susceptibility to damage during photosynthesis and its crucial role in maintaining photosynthetic efficiency under changing environmental conditions.

What methodological approaches can distinguish between subspecies-specific differences in Photosystem Q(B) protein function?

Distinguishing subspecies-specific differences in Photosystem Q(B) protein function between Oryza sativa subsp. indica and japonica requires specialized methodological approaches:

  • Comparative genomics and transcriptomics:

    • Sequence alignment of psbA genes from both subspecies to identify polymorphisms

    • Transcriptome analysis to compare expression levels and potential alternative splicing

  • Protein structure and function analysis:

    • Recombinant expression of both subspecies' proteins under identical conditions

    • Circular dichroism spectroscopy to detect differences in secondary structure

    • Differential scanning calorimetry to compare thermal stability

  • Functional assays with isolated proteins or chloroplasts:

    • Oxygen evolution measurements under different light intensities

    • Electron transport rates measured using artificial electron acceptors

    • Herbicide binding assays (many herbicides target the Q(B) binding site)

  • Hybrid system analysis:

    • Creating chimeric proteins with domains from each subspecies to identify functional differences

    • Complementation studies in mutant systems

  • Environmental response profiling:

    • Comparing photosynthetic parameters under various stress conditions

    • Analyzing protein turnover rates using pulse-chase experiments

These approaches can reveal subtle but potentially significant functional differences that may contribute to subspecies-specific adaptation to different environmental conditions, providing valuable information for rice breeding programs aimed at improving photosynthetic efficiency.

What are the common challenges in expressing and purifying functional recombinant Photosystem Q(B) protein, and how can they be addressed?

Expressing and purifying functional recombinant Photosystem Q(B) protein presents several challenges that researchers commonly encounter:

  • Protein misfolding and inclusion body formation:

    • Challenge: The hydrophobic nature of the protein often leads to misfolding and aggregation in E. coli.

    • Solution: Use lower induction temperatures (16-18°C), specialized E. coli strains (C41, C43), and co-expression with chaperones. Consider addition of mild detergents during cell lysis.

  • Low yield of functional protein:

    • Challenge: Much of the expressed protein may be non-functional.

    • Solution: Optimize codon usage for the expression host, use fusion tags that enhance solubility (MBP, SUMO), and carefully control expression rates with lower inducer concentrations.

  • Protein instability during purification:

    • Challenge: The protein can rapidly lose activity during purification steps.

    • Solution: Maintain samples at 4°C throughout, include stabilizers (6% trehalose, glycerol) in all buffers , minimize time between purification steps, and consider using specialized equipment for membrane protein purification.

  • Cofactor incorporation:

    • Challenge: Obtaining protein with properly incorporated cofactors (chlorophylls, plastoquinone).

    • Solution: Consider plant-based expression systems that naturally contain these cofactors, or develop reconstitution protocols using purified cofactors.

  • Verification of functionality:

    • Challenge: Confirming that the purified protein retains its native electron transport function.

    • Solution: Develop appropriate assays that can detect electron transfer, such as spectroscopic methods or reconstitution into liposomes followed by functional testing.

ChallengeCommon SymptomsRecommended Solutions
Inclusion body formationDense protein band in insoluble fractionLower induction temperature, specialized strains
Low functional yieldActivity measurements below expected valuesOptimize expression conditions, fusion tags
Rapid activity lossDecreasing activity over timeAdd stabilizers, minimize handling time
Poor cofactor incorporationAltered spectral propertiesConsider plant-based expression

Careful consideration of storage conditions is also critical - store in appropriate buffer (Tris/PBS-based with 6% trehalose, pH 8.0) at -20°C/-80°C, and avoid repeated freeze-thaw cycles by creating single-use aliquots .

How can researchers validate the structural integrity and functional activity of purified recombinant Photosystem Q(B) protein?

Validating both the structural integrity and functional activity of purified recombinant Photosystem Q(B) protein requires a multi-faceted approach:

Structural Integrity Validation:

  • SDS-PAGE and Western blotting: Confirms the expected molecular weight (typically achieving >90% purity) and immunological identity using specific antibodies.

  • Circular dichroism (CD) spectroscopy: Provides information about secondary structure elements, which can be compared to native protein.

  • Fluorescence spectroscopy: Intrinsic fluorescence from aromatic amino acids can indicate proper folding.

  • Limited proteolysis: Correctly folded protein typically shows characteristic proteolytic patterns distinct from misfolded versions.

  • Size exclusion chromatography: Confirms the protein exists in the expected oligomeric state and is not aggregated.

Functional Activity Validation:

  • Plastoquinone binding assays: Using fluorescent or radioactive plastoquinone analogs to verify the QB site is functional.

  • Electron transport measurements: When reconstituted into liposomes or proteoliposomes, the protein should support electron transport from artificial donors to acceptors.

  • Herbicide binding studies: Many herbicides (e.g., DCMU, atrazine) bind specifically to the QB site, and binding affinities can indicate proper folding.

  • Reconstitution assays: Incorporation of the purified protein into membrane systems followed by activity measurements.

  • Spectroscopic analysis: Absorption and fluorescence emission spectra can confirm proper incorporation of pigments if relevant.

The optimal approach combines multiple methods to establish both structural and functional integrity. For instance, a well-characterized recombinant protein should show:

  • Expected molecular weight by SDS-PAGE

  • Proper secondary structure by CD spectroscopy

  • Specific binding of plastoquinone analogs

  • Inhibition by known QB-site herbicides at expected concentrations

  • Support of electron transport when properly reconstituted

What emerging technologies hold promise for advancing research on Photosystem Q(B) protein structure and function?

Several cutting-edge technologies are poised to revolutionize research on Photosystem Q(B) protein:

  • Cryo-electron microscopy advancements: Recent progress in cryo-EM has enabled high-resolution structures of membrane protein complexes. Techniques achieving 2.7 Å resolution for photosystem I could be applied to obtain detailed structural information about the Q(B) binding site in different functional states.

  • Time-resolved spectroscopy: Ultrafast spectroscopic techniques with femtosecond resolution allow tracking of electron transfer events in real-time, providing insights into the dynamics of Q(B) reduction and protonation.

  • Single-molecule techniques: Methods such as single-molecule FRET and atomic force microscopy can reveal conformational changes and dynamics that are obscured in ensemble measurements.

  • Advanced computational approaches:

    • Molecular dynamics simulations incorporating quantum mechanical calculations

    • Machine learning approaches for predicting protein-ligand interactions

    • Integrative structural modeling combining data from multiple experimental sources

  • Optogenetic manipulation: Light-activatable systems that can trigger specific changes in photosystem components, allowing precise control over electron transfer processes.

  • Nanoscale imaging: Technologies like super-resolution microscopy and scanning probe microscopy that can visualize the organization and dynamics of photosystems in native membranes.

  • CRISPR-Cas9 gene editing: Precise modification of the psbA gene in vivo to study structure-function relationships in the native context.

These technologies, particularly when used in combination, promise to provide unprecedented insights into the molecular mechanisms of photosynthetic electron transport and could lead to engineered photosystems with enhanced efficiency or novel properties for biotechnological applications.

How might research on Photosystem Q(B) protein contribute to improving photosynthetic efficiency in rice crops?

Research on Photosystem Q(B) protein has significant potential to contribute to improved photosynthetic efficiency in rice crops through several avenues:

Research has already demonstrated that manipulating the expression of photosystem proteins can significantly affect chlorophyll content, photochemical quenching, and photosynthetic electron transport rate in rice , suggesting that targeted modifications of the Q(B) protein could have substantial impacts on crop productivity.

The integration of structural studies, functional analyses, and advanced breeding or gene editing approaches holds particular promise for translating fundamental research on the Q(B) protein into practical applications for agriculture.

What are the key unresolved questions regarding Recombinant Oryza sativa Photosystem Q(B) protein that merit further investigation?

Despite significant advances in our understanding of Photosystem Q(B) protein, several critical questions remain unresolved and warrant further investigation:

  • Structural dynamics during electron transport: How does the protein structure change during the sequential reduction of plastoquinone at the QB site? High-resolution structures of different redox states are needed.

  • Subspecies-specific adaptations: What structural and functional differences exist between the Q(B) protein from indica and japonica subspecies, and how do these differences relate to their adaptation to different environmental conditions?

  • Damage and repair mechanisms: What molecular events trigger the rapid turnover of the D1 protein under high light, and how might these processes be optimized to enhance stress resistance?

  • Interactions with other photosystem components: How does the Q(B) protein interact with other proteins in the photosystem II complex, and how do these interactions affect electron transport efficiency?

  • Post-translational modifications: What roles do post-translational modifications play in regulating Q(B) protein function and turnover? Proteomic studies have identified numerous potential modification sites, but their functional significance remains unclear.

  • Evolutionary conservation and divergence: How have the structure and function of the Q(B) protein evolved across plant species, and what insights can be gained from comparing the rice protein to those from other organisms?

  • Engineering constraints: What are the theoretical and practical limits to engineering the Q(B) protein for enhanced photosynthetic efficiency, and what design principles should guide such efforts?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.