Recombinant Oryza sativa subsp. indica Probable protein-S-isoprenylcysteine O-methyltransferase (ICMT)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Function:
ICMT methylates isoprenylcysteine residues via its methyltransferase activity (EC 2.1.1.100), facilitating carboxyl methylation. This modification influences protein-membrane interactions and signaling pathways .

Sequence:
The full-length recombinant protein comprises 191 amino acids (UniProt: A2XX73) with a predicted molecular weight based on its sequence . Key structural motifs include a conserved methyltransferase domain critical for enzymatic activity.

Taxonomic Origin:
Derived from Oryza sativa subsp. indica, a major rice cultivar in tropical and subtropical regions, this protein shares high homology with its japonica subspecies counterpart but exhibits distinct genomic variations .

Recombinant Production

Expression Systems:

  • Hosts: Escherichia coli, yeast, baculovirus, and mammalian cells .

  • Tags: Often fused with an N-terminal His tag for purification .

  • Purity: ≥85% as confirmed by SDS-PAGE .

Gene Context:

  • The ICMT gene is located on chromosome 3 of the indica genome (assembly GCA_000004655.2) .

  • Comparative genomics reveals ≈15,000–20,000 structural variations between indica and japonica subspecies, influencing gene regulation and protein function .

Key Genomic Studies:

  • A whole-genome shotgun sequencing of indica cv. 93-11 identified 46,022–55,615 genes, with ICMT conserved across subspecies but showing unique regulatory elements .

  • Physical mapping of indica varieties (e.g., Minghui 63) highlighted conserved regions with wild Oryza species, underscoring evolutionary stability of methyltransferase pathways .

Research Applications

Functional Studies:

  • Post-Translational Modification: Used to investigate methylation-dependent protein localization in rice cell membranes .

  • Stress Response: Linked to abiotic stress tolerance via modulation of membrane-bound signaling proteins .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requests. Please indicate your preference in the order remarks, and we will fulfill your requirement to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery information.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50% and can serve as a reference.
Shelf Life
Shelf life is dependent on various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing that specified tag.
Synonyms
ICMT; B0403H10-OSIGBa0105A11.23; OsI_016666; Probable protein-S-isoprenylcysteine O-methyltransferase; Isoprenylcysteine carboxylmethyltransferase; Prenylated protein carboxyl methyltransferase; Prenylcysteine carboxyl methyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-191
Protein Length
full length protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
ICMT
Target Protein Sequence
MAARAQAWLFAAALVIFHGSEYVLAAAFHGRRNVTATSLLISKQYVLAMSFAMLEHLTEA LLFPELKEYWFVSYVGLVMVIIGEVIRKLAVVTAGRSFTHVIRIHYEDQHKLITHGVYRL MRHPGYSGFLIWAVGTQVMLCNPLSTVAFTLVLWRFFSKRIPYEEFFLRQFFGREYEEYA QKVHSGLPFIE
Uniprot No.

Target Background

Function
This enzyme catalyzes the post-translational methylation of isoprenylated C-terminal cysteine residues. Carboxyl methylation is a reversible and potentially regulated step in the post-translational modification of prenylated proteins.
Database Links
Protein Families
Class VI-like SAM-binding methyltransferase superfamily, Isoprenylcysteine carboxyl methyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the fundamental function of ICMT in Oryza sativa subsp. indica?

ICMT (EC 2.1.1.100) in Oryza sativa subsp. indica functions as a methyltransferase that catalyzes the carboxyl methylation of isoprenylcysteine residues in proteins. The enzyme transfers a methyl group from S-adenosyl-L-methionine (SAM) to the carboxyl group of an isoprenylcysteine residue, forming a methyl ester and S-adenosyl-L-homocysteine as products . This post-translational modification is critical for proper protein localization and function, particularly for proteins involved in signal transduction pathways and stress responses. The reaction typically occurs at the endoplasmic reticulum membrane where ICMT is localized.

The catalytic mechanism involves substrate binding, methyl transfer, and product release in a sequential manner. Studies indicate that ICMT activity can be regulated by various cellular conditions, including redox state, which may connect to its role in oxidative stress responses observed in rice subspecies. The enzyme is classified as a methyltransferase with the full name "protein-S-isoprenylcysteine O-methyltransferase" and is also known as isoprenylcysteine carboxylmethyltransferase in various research contexts .

  • How can researchers identify and characterize ICMT gene sequence variations between rice subspecies?

Characterizing ICMT gene sequence variations between rice subspecies requires a multi-faceted approach combining genomic, transcriptomic, and functional analyses. Begin with sequence alignment of ICMT genes from indica (B0403H10-OSIGBa0105A11.23; OsI_016666) and japonica subspecies to identify single nucleotide polymorphisms (SNPs), insertions/deletions, and variations in regulatory regions . PCR amplification and sequencing of ICMT genes from multiple varieties within each subspecies will help determine intra-subspecies conservation and inter-subspecies variation patterns.

For comprehensive analysis, researchers should examine both coding and non-coding regions, as variations in promoters, introns, and untranslated regions can significantly affect expression patterns and mRNA stability. Transcriptome analysis using RNA-seq can identify alternative splicing events that might differ between subspecies. For functional characterization, conduct comparative promoter analysis using reporter gene assays to assess regulatory differences . Expression pattern comparison under various environmental conditions can reveal subspecies-specific regulation mechanisms, particularly relevant given the observed differences in stress responses between indica and japonica rice .

  • What are the optimal expression systems for producing recombinant Oryza sativa subsp. indica ICMT?

Several expression systems can be used for producing recombinant Oryza sativa subsp. indica ICMT, each with specific advantages depending on research objectives. The choice of expression system should be guided by considerations of yield, protein folding, post-translational modifications, and intended applications. Based on available research data, the following systems have been successfully employed:

Expression SystemAdvantagesLimitationsTypical YieldPurification Strategy
E. coliRapid growth, cost-effective, well-established protocolsPotential protein insolubility, lacks eukaryotic PTMs10-50 mg/LIMAC (His-tag), GST-tag purification
Yeast (P. pastoris)Eukaryotic processing, proper protein foldingLonger expression time, hyperglycosylation5-20 mg/LAffinity chromatography, size exclusion
Baculovirus-Insect cellAdvanced eukaryotic processing, suitable for membrane proteinsTechnical complexity, higher cost1-10 mg/LAffinity purification, density gradient
Mammalian cellAuthentic post-translational modificationsHighest cost, lowest yield0.5-5 mg/LImmunoaffinity, multi-step chromatography
  • What experimental approaches can determine ICMT substrate specificity in rice?

Determining ICMT substrate specificity requires complementary approaches that identify both the recognition elements within substrates and the enzyme's preference patterns. Begin with in vitro assays using synthetic peptide libraries containing isoprenylcysteine residues with systematic variations in flanking sequences . Measure methylation rates using radiometric assays with [³H]-SAM or fluorescence-based detection methods to generate a position-specific scoring matrix for substrate preference.

For identification of natural substrates, employ proteomics approaches using stable isotope labeling. Conduct comparative proteomics between wild-type plants and those with altered ICMT expression to identify differentially methylated proteins . Confirmation of direct methylation should follow using in vitro assays with recombinant ICMT and candidate substrate proteins. For substrate validation, perform site-directed mutagenesis of predicted methylation sites in candidate proteins and assess the impact on methylation status and subcellular localization.

Structure-activity relationship studies with modified substrates can provide insight into the molecular requirements for ICMT recognition. For instance, testing substrates with different prenyl moieties (farnesyl vs. geranylgeranyl) can reveal preferences in the hydrophobic binding pocket . These approaches collectively provide a comprehensive profile of ICMT substrate specificity in rice.

Advanced Research Questions

  • How can researchers effectively design comparative studies between ICMT from indica and japonica rice subspecies?

Designing rigorous comparative studies between ICMT from indica and japonica subspecies requires careful consideration of genetic material selection, experimental variables, and analytical approaches. The experimental design should account for both genetic and environmental factors that might influence the observed differences.

First, select genetically pure, well-characterized lines of both subspecies and grow plants under identical controlled conditions to minimize environmental variables . Standardize developmental stages for sample collection and include sufficient biological replicates (minimum n=5) for statistical robustness. Control for growth conditions (temperature, light, humidity), stress application methods, and tissue sampling procedures to ensure valid comparisons.

Implement a multi-level analysis approach that examines:

Analysis LevelMethodsKey ParametersData Interpretation Approach
GenomicSequencing, PCRSNPs, regulatory elementsPhylogenetic analysis, variant prediction
TranscriptomicqRT-PCR, RNA-seqExpression levels, splicingDifferential expression analysis
ProteomicWestern blot, mass spectrometryProtein abundance, PTMsPathway enrichment analysis
EnzymaticIn vitro activity assaysKm, Vmax, substrate specificityMichaelis-Menten kinetics
PhenotypicGrowth measurements, stress assaysBiomass, stress damage indicatorsCorrelation analysis

When comparing enzymatic properties, ensure identical assay conditions and substrate preparations . For phenotypic studies, apply methodical stress treatments with graduated intensity to capture potential threshold effects. Statistical analysis should account for multiple testing using FDR correction and consider both biological and technical variability sources.

  • What approaches are most effective for studying ICMT's role in rice oxidative stress response?

Given that rice subspecies show significant phenotypic variation in stress responses and that oxidative stress produces reactive oxygen species (ROS), studying ICMT's role in this context requires a multi-faceted approach that integrates genetic, molecular, and physiological analyses .

Begin with gene expression analysis comparing ICMT expression levels between indica and japonica subspecies under normal and oxidative stress conditions using qRT-PCR and RNA-seq . Conduct time-course experiments to capture dynamic changes in expression following stress application. For genetic modification studies, implement CRISPR/Cas9-mediated knockout or knockdown of ICMT, complemented by overexpression studies using native or constitutive promoters.

For phenotypic characterization, assess oxidative stress tolerance in modified plants using methyl viologen (MV) treatment, which produces ROS and can induce leaf senescence as observed in indica seedlings (93-11) . Measure physiological parameters including photosynthetic efficiency (Fv/Fm), membrane integrity (electrolyte leakage), and ROS accumulation using specific dyes (H₂DCFDA, DAB staining).

Biochemical investigation should identify ICMT substrates that change methylation status during stress and analyze enzyme kinetics under different redox conditions. Experimental designs must include proper controls including multiple independent transgenic lines, wild-type controls of the same genetic background, and time-course measurements to capture the dynamic nature of stress responses.

  • What methodological challenges exist in purifying active recombinant ICMT, and how can they be addressed?

Purifying active recombinant ICMT from Oryza sativa subsp. indica presents several challenges due to its nature as a membrane-associated methyltransferase. The major challenges and their solutions include:

Membrane association and hydrophobicity pose significant extraction difficulties. Address this by using specialized detergents (DDM, CHAPS, Triton X-100) during extraction and consider fusion tags that enhance solubility (SUMO, MBP) . Maintaining enzymatic activity during purification requires including stabilizing agents (glycerol 10-20%, reducing agents) and minimizing purification steps and processing time .

Protein aggregation and precipitation often occur during concentration steps. Screen buffer conditions systematically (pH, ionic strength, additives) and implement size exclusion chromatography as a final polishing step. Low expression yield can be addressed by optimizing codon usage for the expression host and testing different promoter systems and induction conditions .

An optimized purification workflow should include:

  • Cell lysis with gentle mechanical disruption in buffer containing protease inhibitors

  • Membrane fraction isolation via ultracentrifugation at 100,000 × g

  • Solubilization with carefully titrated detergent concentration

  • Affinity purification followed by ion exchange chromatography

  • Size exclusion chromatography to separate monomeric active enzyme from aggregates

  • Activity verification with model substrates

  • Storage with cryoprotectants in small aliquots

The purity should be ≥85% as determined by SDS-PAGE for most research applications .

  • How can researchers optimize ICMT activity assays for high-throughput screening?

Optimizing ICMT activity assays for high-throughput screening requires balancing sensitivity, reliability, and throughput while maintaining biological relevance. Begin by selecting appropriate substrates—synthetic fluorogenic or luminescent substrates offer advantages for detection, while peptide-based substrates with FRET pairs can provide real-time activity monitoring .

Adapt detection methods to plate-based formats, considering fluorescence polarization for binding and activity assays, AlphaScreen or HTRF for proximity-based detection, or coupled enzyme assays with colorimetric readouts. Miniaturize the assay to 384-well formats with reduced reaction volumes (5-20 μL) while optimizing reagent concentrations to maintain signal-to-noise ratios .

Assay FormatPrincipleAdvantagesLimitationsThroughput
Radiometric[³H]-SAM incorporationHigh sensitivityRadioactive wasteMedium
Fluorescence intensityDirect fluorescent substrateSimple setupPotential interferenceHigh
FRET-basedEnergy transfer upon methylationRatiometricComplex substrate designVery high
Coupled enzymeLink to NAD(P)H-producing reactionColorimetricIndirect measurementHigh
MS-basedDirect product detectionDefinitive identificationLower throughputLow to medium

Implement rigorous quality control by including positive and negative controls in each plate and calculating Z' factor to assess assay quality (aim for >0.5). Develop automated data processing scripts and establish clear hit criteria (typically >3SD from controls). The optimization process should follow a systematic workflow: establish the assay in standard format, perform miniaturization studies, conduct a pilot screen with diverse compounds, analyze reproducibility, and then implement full-scale screening .

Methodology and Technical Considerations

  • What are the optimal conditions for expressing recombinant ICMT from Oryza sativa subsp. indica in E. coli?

Optimizing expression of recombinant ICMT from E. coli requires systematic evaluation of multiple parameters affecting protein yield and activity. Vector design should incorporate a strong but controllable promoter (T7, tac) and include a fusion tag for detection and purification (6xHis, GST) . Codon optimization for E. coli is essential, especially for rare codons frequently found in plant genes.

An optimization matrix for key expression parameters might include:

ParameterTest RangeMonitoring MethodSuccess Indicator
Temperature16°C, 25°C, 37°CSDS-PAGE of soluble fractionIncreased band intensity in soluble fraction
IPTG concentration0.1, 0.5, 1.0 mMWestern blotOptimal expression without toxicity
Media compositionLB, TB, 2XYTBiomass and expression levelHighest protein yield per liter
Detergent typeDDM, CHAPS, Triton X-100Extraction efficiencyMaximum protein recovery with activity

Lysis and extraction buffers typically include 50 mM Tris-HCl or HEPES (pH 7.5-8.0), 150-500 mM NaCl, appropriate detergent, and 10-20% glycerol with reducing agents . Purification strategy should utilize affinity chromatography based on the fusion tag, followed by secondary purification steps as needed. The goal should be to achieve ≥85% purity as determined by SDS-PAGE while maintaining enzymatic activity .

  • How can researchers accurately measure ICMT enzyme kinetics between rice subspecies?

Accurate measurement and comparison of ICMT enzyme kinetics between rice subspecies requires standardized enzyme preparation, optimized reaction conditions, and rigorous data analysis. Begin by standardizing enzyme preparation using identical expression systems and purification protocols for both subspecies' enzymes . Verify protein concentration using multiple methods (Bradford, BCA, absorbance at 280 nm) and assess enzyme purity by SDS-PAGE and mass spectrometry.

Optimize reaction conditions by determining the optimal pH, temperature, and buffer composition for each enzyme. Establish the linear range for reaction time and enzyme concentration through preliminary experiments. The substrate concentration range should be based on preliminary Km estimates, typically spanning 0.2-5× Km with at least 7-8 data points .

For kinetic parameter determination:

ParameterDetermination MethodSignificanceReporting Standard
KmNon-linear regressionSubstrate affinityμM with 95% confidence intervals
VmaxNon-linear regressionMaximum velocitynmol/min/mg enzyme
kcatCalculation from VmaxCatalytic rate constants⁻¹
kcat/KmCalculationCatalytic efficiencyM⁻¹s⁻¹

Perform reactions in triplicate at minimum and use appropriate model fitting (Michaelis-Menten, Hill equation). For advanced kinetic analysis, consider product inhibition studies, dead-end inhibitor analysis, or bi-substrate kinetic analysis for SAM and isoprenylcysteine substrate interactions .

Data analysis should include statistical comparison of parameters using t-test or ANOVA and bootstrap analysis for confidence interval estimation. Proper propagation of errors in calculated parameters ensures reliable comparisons between enzymes from different subspecies.

  • What approaches should be used to investigate structure-function relationships in ICMT?

Investigating structure-function relationships of ICMT requires a combination of computational, biochemical, and biophysical approaches that collectively provide insights into the enzyme's mechanism and substrate interactions.

Begin with computational structure prediction through homology modeling based on known structures of related methyltransferases . Use molecular dynamics simulations to predict flexibility and substrate binding modes. Identify conserved catalytic residues through multiple sequence alignment of ICMT from various species and rice subspecies. These predictions guide experimental design for functional validation.

For experimental structure determination, consider X-ray crystallography (challenging for membrane proteins), cryo-electron microscopy for higher molecular weight complexes, or hydrogen-deuterium exchange mass spectrometry to map protein dynamics . Functional validation should employ alanine scanning mutagenesis of predicted catalytic and substrate-binding residues, testing both conservative and non-conservative substitutions to establish chemical requirements for activity.

Create chimeric proteins between indica and japonica ICMT to map functional domains responsible for any observed differences in activity or specificity . For structure-guided inhibitor development, conduct virtual screening of compound libraries against computational models and perform structure-activity relationship studies with synthetic substrates and inhibitors.

The integration of structural data with functional assays provides a comprehensive understanding of how sequence variations between rice subspecies might translate to functional differences in ICMT activity, substrate preference, or regulation mechanisms.

  • How should researchers design field experiments to study ICMT function in rice under natural conditions?

Designing field experiments to study ICMT function in rice under natural conditions requires careful planning that balances experimental control with agricultural relevance. Begin by selecting appropriate field sites that represent target environments for rice cultivation and include multiple locations to account for environmental variation .

Plot design considerations should include:

  • Plot size: Typically 1-5 m² for genetic studies, larger for agronomic trials

  • Plot shape: Rectangular plots generally provide better precision than square plots

  • Border effect management: Include adequate borders (minimum 30 cm) to minimize edge effects

  • Number of replications: Minimum 4 replications recommended for adequate statistical power

For experimental design, randomized complete block designs are suitable for simple experiments with few treatments, while split-plot designs allow testing of multiple factors (e.g., genotype and environmental treatments) . Consider soil heterogeneity when designing blocks—when soil variation is as great in one direction as another, blocking direction is not critical, but in fields with gradients, blocks should be perpendicular to the gradient .

Data collection should include:

  • Phenotypic measurements: Growth parameters, yield components, stress symptoms

  • Physiological measurements: Photosynthetic parameters, ROS indicators

  • Tissue sampling for molecular analysis: Preserve material appropriately for RNA/protein extraction

  • Environmental monitoring: Temperature, rainfall, light intensity, soil moisture

Statistical analysis must account for spatial variation and environmental factors. The coefficient of variation for rice yield trials typically ranges around 8-10% at established research farms but may be higher in less controlled environments .

  • What methods are most effective for studying ICMT localization in rice tissues?

Studying ICMT localization in rice tissues requires complementary techniques that provide information at different resolution levels, from tissue-specific expression to subcellular localization.

For transcript-level analysis, employ quantitative RT-PCR for tissue-specific expression using multiple reference genes for normalization . In situ hybridization provides cellular resolution of expression patterns through specific RNA probe hybridization to fixed tissue sections. RNA-seq offers global expression patterns across tissues and developmental stages, enabling the identification of co-expressed genes that may function with ICMT .

At the protein level, generate specific antibodies against ICMT for immunolocalization studies . Optimize fixation and antigen retrieval protocols for rice tissues, which can be challenging due to silicon content and cell wall structures. Alternatively, create reporter gene fusions (GFP/YFP) that preserve ICMT function while enabling visualization . Both promoter-reporter constructs (for expression pattern) and protein fusions (for subcellular localization) provide valuable information.

ApproachResolutionInformation ProvidedTechnical Considerations
qRT-PCRTissueQuantitative expression levelsReference gene validation critical
In situ hybridizationCellularSpatial expression patternLabor-intensive optimization
ImmunolocalizationSubcellularProtein localizationAntibody specificity crucial
Reporter fusionsSubcellular/tissueDynamic localizationPotential fusion artifacts
Biochemical fractionationSubcellularCompartment associationSample purity important

For dynamic analysis, employ live cell imaging with fluorescent tags and techniques like FRAP (Fluorescence Recovery After Photobleaching) to study protein mobility. Design experiments to capture developmental time series, stress-responsive changes, and tissue-specific patterns to develop a comprehensive understanding of ICMT localization in relation to its function .

  • How can researchers investigate the impact of genetic variation on ICMT function across rice varieties?

Investigating the impact of genetic variation on ICMT function across rice varieties requires an integrated approach that connects sequence polymorphisms to functional differences and ultimately to phenotypic variation.

Begin with comprehensive sequence analysis of ICMT genes from diverse rice varieties, including both cultivated subspecies (indica and japonica) and wild relatives . Identify single nucleotide polymorphisms (SNPs), insertions/deletions, and variations in regulatory regions that might affect expression or function. Population genetic analysis can reveal patterns of selection that might indicate functional importance of specific variants.

For functional characterization, express variant ICMT proteins in heterologous systems and compare their enzymatic properties . Develop allele-specific markers for tracking ICMT variants in breeding populations and association studies. Conduct association analysis between ICMT variants and phenotypic traits related to development and stress responses across diverse rice germplasm.

Create near-isogenic lines (NILs) differing only in ICMT alleles to directly assess phenotypic effects without confounding genetic background variation. For mechanistic understanding, perform comparative transcriptomics and proteomics between lines carrying different ICMT variants to identify downstream pathways affected by the variation .

Combine genetic and biochemical data to develop predictive models of how specific sequence variations affect ICMT function. This integrated approach allows researchers to connect molecular-level variation to phenotypic differences observed between rice varieties, particularly in stress response traits where ICMT may play an important role .

  • What considerations are important when designing experiments to investigate ICMT's role in rice-pathogen interactions?

Investigating ICMT's role in rice-pathogen interactions requires careful experimental design that addresses both the plant and pathogen components of the interaction, as well as the temporal dynamics of the infection process.

Begin by selecting appropriate pathosystems that represent major rice diseases (bacterial blight, rice blast, sheath blight) and include both compatible (susceptible) and incompatible (resistant) interactions. Generate rice lines with altered ICMT expression (overexpression, knockdown, knockout) in both resistant and susceptible genetic backgrounds to assess the impact on disease progression .

For inoculation experiments, standardize pathogen inoculum preparation, concentration, and application methods. Implement both controlled environment and field inoculations to capture environment-dependent effects. Design time-course experiments that capture early signaling events (hours post-inoculation) through to disease development (days to weeks post-inoculation).

Analytical approaches should include:

  • Disease scoring using standardized scales

  • Microscopic analysis of infection structures and plant cellular responses

  • Measurement of defense-related compounds (phytoalexins, PR proteins)

  • Gene expression analysis of defense signaling pathways

Investigate potential ICMT substrates involved in defense responses through proteomics approaches comparing wild-type and ICMT-modified plants during infection . Test whether pathogen effectors target ICMT or ICMT-methylated proteins using co-immunoprecipitation and protein interaction studies.

Consider the intersection between pathogen response and other stress pathways, particularly oxidative stress, which often features prominently in plant defense responses and may connect to ICMT's potential role in stress response mechanisms observed in rice subspecies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.