Recombinant Oryza sativa subsp. indica Probable xyloglucan glycosyltransferase 2 (CSLC2)

Shipped with Ice Packs
In Stock

Description

Protein Overview

CSLC2 belongs to the cellulose synthase-like C (CSLC) family of glycosyltransferases, which catalyze the transfer of xylosyl residues to the xyloglucan backbone. Xyloglucan serves as a cross-linking polysaccharide in primary cell walls, influencing cell expansion and mechanical strength . Recombinant CSLC2 is produced in E. coli with an N-terminal His tag, facilitating purification via affinity chromatography .

Functional Role in Xyloglucan Biosynthesis

CSLC2 is implicated in the synthesis of the xyloglucan backbone, a process critical for plant development:

  • Enzymatic Activity: Members of the CSLC family, including CSLC2, are glucan synthases that polymerize glucose into the β-1,4-glucan backbone of xyloglucan .

  • Genetic Evidence: Arabidopsis CSLC mutants exhibit severe reductions in xyloglucan content, confirming the family’s non-redundant role in xyloglucan production .

  • Structural Specificity: CSLC enzymes determine the substitution pattern of xyloglucan sidechains (e.g., "U" sidechains with β-xylopyranosyl residues) .

Research Applications

Recombinant CSLC2 is utilized in:

  • Enzyme Kinetics: Assessing substrate specificity and catalytic efficiency.

  • Structural Studies: Investigating protein domains influencing regioselectivity (e.g., Alphafold-predicted structures highlight conserved GT47 family motifs) .

  • Plant Biotechnology: Engineering crops with modified cell wall properties for improved biomass digestibility .

Comparative Analysis with Related CSLC Proteins

FeatureCSLC2 (O. sativa indica)CSLC9 (O. sativa japonica) CSLC10 (O. sativa indica)
Protein Length (aa)Data unavailable595686
UniProt IDUnreportedQ6AU53A2YHR9
Key DomainsGT47 family motifsHis-tagged full-length expressionHis-tagged full-length expression

Note: CSLC2’s exact sequence and domains remain uncharacterized in public databases, but homology modeling suggests structural similarities to other CSLC proteins .

Challenges and Future Directions

  • Sequence Gaps: The full amino acid sequence of CSLC2 is not publicly available, limiting structural predictions.

  • Functional Validation: Heterologous expression in Arabidopsis mutants (e.g., mur3 xlt2) could confirm enzymatic activity and rescue phenotypes .

  • Evolutionary Context: Phylogenetic analysis of CSLC genes across monocots and dicots may clarify functional diversification .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
CSLC2; OsI_030406; Probable xyloglucan glycosyltransferase 2; Cellulose synthase-like protein C2; OsCslC2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-698
Protein Length
full length protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
CSLC2
Target Protein Sequence
MAPPGVGVGVAYLWGKGRGGRKGTPVVVTMESPNYSVVEVDGPDAEAELRTAAVAMDKGG GRGRSRSRTARQLTWVLLLRARRAAGRLASFAAAAARRFRRSPADAADELGRGRGRLMYG FIRGFLALSLLALAVELAAYWNGWRLRRPELHVPEAVEIEGWAHSAYISWMSFRADYIRR PIEFLSKACILLFVIQSMDRLVLCLGCFWIKLRKIKPRIEGDPFREGSGYQHPMVLVQIP MCNEKEVYEQSISAACQLDWPREKFLIQVLDDSSDESIQLLIKAEVSKWSHQGVNIVYRH RVLRTGYKAGNLKSAMSCDYVKDYEFVAIFDADFQPTPDFLKKTIPHFEGNPELGLVQAR WSFVNKDENLLTRLQNINLCFHFEVEQQVNGVFLNFFGFNGTAGVWRIQALEESGGWLER TTVEDMDIAVRAHLNGWKFIFLNDVKVLCELPESYEAYRKQQHRWHSGPMHLFWLCLPDI LTAKISSWKKANLILLFFLLRKLILPFYSFTLFCVILPLTMFVPEAELPVWVICYVPVCM SFLNILPSPRSFPFIVPYLLFENTMSVTKFNAMVSGLFKLGSSYEWIVTKKSGRSSESDL STAVERDTKDLTLPRLQKQISESELIDLKMQKERQEKAPLGAKKANKIYKKELALSLLLL TAATRSLLSAQGIHFYFLLFQGVSFLFVGLDLIGEQID
Uniprot No.

Target Background

Function
This protein is likely a beta-1,4-glucan synthase involved in the synthesis of the xyloglucan backbone, rather than cellulose. It appears to function concurrently with xyloglucan 6-xylosyltransferase. Xyloglucan is a noncellulosic polysaccharide found in plant cell walls. It comprises a glucan backbone with substitutions of xylose, galactose, and fucose.
Database Links
Protein Families
Glycosyltransferase 2 family, Plant cellulose synthase-like C subfamily
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and predicted topology of CSLC2?

CSLC2 (Oryza sativa subsp. indica probable xyloglucan glycosyltransferase 2) is an integral membrane protein with a predicted six transmembrane domain (TMD) structure. The protein belongs to the cellulose synthase-like C (CSLC) family of glycosyltransferases, which are members of CAZy GT family 2 . The complete amino acid sequence of CSLC2 consists of 698 amino acids as documented in sequence databases .

Structurally, CSLC2 features important catalytic domains typical of inverting integral membrane glycosyltransferases. The catalytic domain is situated on the cytoplasmic side of the membrane, where it can access its substrate UDP-glucose. Like other CSLC proteins, it likely contains a channel formed by its transmembrane domains that facilitates the translocation of the synthesized glucan chain through the Golgi membrane into the lumen .

What is the primary function of CSLC2 in rice cell wall biosynthesis?

CSLC2 functions as a glycosyltransferase involved in the synthesis of the β-(1→4)-glucan backbone of xyloglucan (XyG), a major hemicellulose component of plant cell walls. The enzyme uses UDP-glucose as a donor substrate to catalyze the formation of β-(1→4) linkages between glucose residues, creating the glucan backbone of xyloglucan .

The mechanism involves:

  • Reception of UDP-glucose on the cytoplasmic side

  • Catalytic elongation of the glucan chain

  • Translocation of the growing polysaccharide through the Golgi membrane

  • Further glycosylation of the backbone by other glycosyltransferases in the Golgi lumen

This process is essential for proper cell wall development in rice and affects various properties including structural integrity and potential responses to environmental stresses.

How does CSLC2 relate to other members of the CESA/CSL superfamily?

CSLC2 is part of the CESA/CSL (Cellulose Synthase/Cellulose Synthase-Like) superfamily, which has been extensively characterized in rice through phylogenetic, transcriptional profiling, and co-expression analyses . The CESA/CSL superfamily in rice exhibits notable differences compared to Arabidopsis, reflecting the distinct cell wall compositions between monocots and dicots .

In phylogenetic analyses, the CESA/CSL genes have been classified into two main clusters based on their evolutionary relationships and motif constitution . The expansion of this superfamily has been significantly influenced by gene duplication events:

  • Cluster I genes (which likely include CSLC2) primarily expanded through tandem duplication

  • Cluster II genes expanded mainly through segmental duplication

What differences exist between CSLC2 in Oryza sativa subsp. indica versus subsp. japonica?

Both Oryza sativa subsp. indica and subsp. japonica express CSLC2 as a functional xyloglucan glycosyltransferase, though subtle differences may exist in their protein sequences that could affect enzymatic efficiency or regulation . The recombinant versions of CSLC2 from both subspecies are available as research tools, suggesting their importance in understanding rice cell wall biosynthesis across different rice varieties .

While the specific functional differences between indica and japonica CSLC2 are not fully characterized in the provided literature, genomic studies have revealed that the genetic systems underlying adaptation of different rice subspecies show notable variation . These differences could potentially extend to cell wall-related genes like CSLC2, especially considering the distinct environmental adaptations of indica and japonica rice varieties.

How is CSLC2 expression regulated throughout rice development?

The expression patterns of CESA/CSL genes in rice vary considerably throughout plant development. While specific CSLC2 expression data isn't directly provided, studies of the CESA/CSL superfamily in rice have shown that some members from each CSL family (including A1, C9, D2, E1, F6, and H1) are expressed in all tissues throughout the plant's life cycle, while many other CSL genes show tissue-specific expression patterns, particularly in reproductive tissues like stamen and in root tissues such as radicles .

Expression profiling conducted across 33 tissue samples covering the entire life cycle of rice revealed variable expression patterns for CSL genes . This suggests that CSLC2 likely has a specific expression pattern that correlates with its function in cell wall synthesis during particular developmental stages or in specific tissues of the rice plant.

What catalytic mechanism governs CSLC2 enzymatic activity?

CSLC2, like other CSLC enzymes, likely catalyzes the transfer of glucose from UDP-glucose to a growing β-glucan polymer through an SN2 reaction mechanism, which inverts the anomeric configuration from α to β . This reaction occurs in the cytoplasmic catalytic domain of the enzyme.

The catalytic process likely follows these steps:

  • Binding of UDP-glucose in the catalytic site

  • Nucleophilic attack by the hydroxyl group of the acceptor glucose

  • Formation of a β-(1→4) glycosidic bond with inversion of configuration

  • Release of UDP

  • Translocation of the elongated chain through the membrane channel

The enzyme's active site likely contains conserved residues that coordinate the substrate and facilitate the reaction. Based on homology with other GT2 family enzymes, CSLC2 might contain a QxxRW motif near the channel entrance that stabilizes the acceptor through π and hydrogen bonds, along with a finger helix containing a TED motif that forms hydrogen bonds with the terminal glucose residue .

How can researchers overcome challenges in expressing functional recombinant CSLC2?

Expressing functional recombinant CSLC2 presents several challenges due to its membrane-integrated nature. Based on studies with related proteins, researchers should consider:

  • Expression system selection: While bacterial systems are simpler, eukaryotic systems like Pichia pastoris may be more suitable for proper folding and post-translational modifications. Studies have shown successful expression of recombinant CSLC4 (a related protein) in P. pastoris with confirmed β-glucan synthesis activity .

  • Construct design considerations:

    • Inclusion of appropriate purification tags (typically at the N-terminus to avoid interfering with C-terminal processing)

    • Codon optimization for the expression system

    • Addition of signal sequences for proper membrane insertion

    • Possible use of truncated constructs that retain catalytic activity if full-length protein expression is problematic

  • Purification approaches:

    • Use of mild detergents for solubilization (e.g., n-dodecyl-β-D-maltoside)

    • Inclusion of glycerol in buffers to maintain protein stability

    • Step-wise purification using affinity chromatography followed by size exclusion

    • Storage in Tris-based buffer with 50% glycerol as recommended for the commercially available recombinant protein

  • Activity verification: Development of appropriate assays to confirm that the recombinant protein maintains its catalytic activity after purification.

What methodologies are most effective for studying CSLC2 enzymatic activity in vitro?

Several approaches can be employed to study CSLC2 enzymatic activity:

  • Radioactive incorporation assays: Using radiolabeled UDP-glucose as substrate and measuring incorporation into glucan polymers.

  • HPLC-based assays: Monitoring the consumption of UDP-glucose and/or production of UDP.

  • Mass spectrometry: Analyzing the structure and length of synthesized products.

  • Acceptor substrate variations: Using various oligosaccharides as acceptors to study substrate specificity. Cellohexaose has been successfully used as an acceptor in studies with related XXTs (xylosyltransferases) .

  • Product characterization: Employing enzymatic digestion followed by HPAEC-PAD (High-Performance Anion-Exchange Chromatography with Pulsed Amperometric Detection) to characterize the structure of synthesized glucan chains.

When designing these assays, researchers should consider:

  • Buffer composition and pH optimization

  • Metal ion requirements (often Mg²⁺ or Mn²⁺)

  • Detergent selection and concentration

  • Incubation time and temperature optimization

  • Product detection methods

What approaches should be used to study CSLC2 interactions with other cell wall biosynthesis proteins?

Understanding CSLC2's interactions with other proteins is crucial for comprehending the complete xyloglucan biosynthesis pathway. Effective approaches include:

  • Co-immunoprecipitation (Co-IP): Using antibodies against CSLC2 to pull down interacting proteins, followed by mass spectrometry identification.

  • Yeast two-hybrid (Y2H) assays: Despite limitations with membrane proteins, modified split-ubiquitin Y2H systems can be effective for studying membrane protein interactions.

  • Bimolecular Fluorescence Complementation (BiFC): For visualizing in vivo protein interactions by expressing protein fragments fused to complementary portions of a fluorescent protein.

  • Förster Resonance Energy Transfer (FRET): For studying protein proximity and interactions in living cells.

  • Co-expression analysis: Computational approaches analyzing gene co-expression networks can predict functional associations. This has been successfully applied to CESA/CSL genes in rice to identify potential functional complements and associations for cell wall synthesis .

  • Proteomics of isolated Golgi fractions: To identify proteins that co-localize with CSLC2 in its native membrane environment.

  • Genetic approaches: Creating double or multiple mutants to identify genetic interactions between CSLC2 and other glycosyltransferases.

How does CSLC2 function contribute to xyloglucan structure in rice cell walls?

CSLC2 synthesizes the β-(1→4)-glucan backbone of xyloglucan, which is subsequently modified by other glycosyltransferases to create the complete xyloglucan structure. The specific contribution of CSLC2 to xyloglucan structure includes:

  • Backbone synthesis: CSLC2 creates the essential backbone that serves as the acceptor substrate for further modifications.

  • Chain length determination: The processivity of CSLC2 likely influences the length of the xyloglucan molecule.

  • Structural integration: The glucan backbone synthesized by CSLC2 provides the framework for xyloglucan's interaction with cellulose microfibrils in the cell wall.

The complete xyloglucan structure requires additional enzymes, particularly xylosyltransferases (XXTs) that add xylose residues to specific positions on the glucan backbone. Research has shown that XXTs follow rules such as the "N+2 rule" for backbone xylosylation in Arabidopsis, where XXTs (XXT1 and XXT2) have steric hindrance preventing xylosylation of the N+2 position when the N position is already xylosylated .

Different patterns of xylosylation (XGGGGG, XXGGGG, XXXGGG, and XXXXGG) have been observed in biochemical assays , and the specific pattern in rice cell walls may depend on the coordinated action of CSLC2 and rice-specific XXTs.

What genomic approaches can be used to identify and characterize CSLC2 variants in different rice cultivars?

Researchers can utilize several genomic approaches to identify and characterize CSLC2 variants:

  • Whole Genome Sequencing (WGS): Provides comprehensive identification of variants including SNPs, insertions/deletions, and structural variations in CSLC2 across rice cultivars. This approach has been used successfully to sequence diverse rice accessions .

  • Genome-Wide Association Studies (GWAS): Can identify associations between CSLC2 variants and phenotypic traits. This approach has been applied successfully to study various traits in rice, including stress responses .

  • Targeted sequencing approaches:

    • Amplicon sequencing of CSLC2 and its regulatory regions

    • Capture-based sequencing focusing on cell wall-related genes

    • RNA-seq for expression analysis in different cultivars

  • Database utilization: Existing rice genome databases can be queried for CSLC2 variants. The Hidden Markov Model (HMM) profile of the cellulose synthase domain (PF03552) can be used to identify CSLC genes from rice genomes .

  • Bioinformatic analysis workflow:

    • Sequence alignment of CSLC2 variants

    • Phylogenetic analysis to understand evolutionary relationships

    • Structural prediction to assess functional implications of variants

    • Promoter analysis to identify regulatory differences

    • Integrated analysis with expression data to correlate genotype with phenotype

What are the recommended protein purification protocols for obtaining active recombinant CSLC2?

Based on information about similar proteins, the following purification protocol is recommended:

  • Expression system selection: Pichia pastoris has been successful for expressing functional CSLC proteins .

  • Cell lysis and membrane preparation:

    • Mechanical disruption in appropriate buffer (typically pH 7.4-8.0)

    • Differential centrifugation to isolate membrane fractions

    • Solubilization using mild detergents (e.g., n-dodecyl-β-D-maltoside)

  • Affinity purification:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged proteins

    • Anti-tag antibody affinity purification for other tag types

  • Further purification:

    • Size exclusion chromatography

    • Ion exchange chromatography if needed

  • Buffer optimization:

    • Final storage in Tris-based buffer with 50% glycerol as recommended for the commercially available recombinant protein

    • Aliquoting and storage at -20°C for short-term or -80°C for long-term preservation

    • Avoiding repeated freeze-thaw cycles

  • Quality control:

    • SDS-PAGE and Western blotting to confirm purity and identity

    • Activity assays to confirm functionality

How can CRISPR-Cas9 gene editing be optimized for studying CSLC2 function in rice?

CRISPR-Cas9 offers powerful approaches for studying CSLC2 function through various gene editing strategies:

  • Guide RNA design considerations:

    • Target conserved catalytic domains for complete loss-of-function

    • Target specific domains to study their individual contributions

    • Multiple gRNAs for complete gene knockout

    • Use rice-optimized promoters for gRNA expression

  • Editing strategies:

    • Knockout: Complete gene disruption to study loss-of-function phenotypes

    • Base editing: For introducing specific point mutations without double-strand breaks

    • Prime editing: For precise edits including insertions, deletions, and substitutions

    • Knock-in: Adding reporter tags for protein localization studies

  • Transformation approaches:

    • Agrobacterium-mediated transformation

    • Particle bombardment for recalcitrant varieties

    • Protoplast transformation for transient studies

  • Screening and validation:

    • PCR-based genotyping

    • Sanger sequencing for confirmation

    • Expression analysis using qRT-PCR

    • Protein analysis via Western blotting

    • Cell wall composition analysis using biochemical assays

  • Phenotypic analysis:

    • Cell wall composition analysis

    • Plant growth and development monitoring

    • Stress response evaluation

    • Microscopic analysis of cell wall structure

What imaging techniques are most effective for visualizing CSLC2 localization and trafficking?

Several imaging techniques can be employed to study CSLC2 localization and trafficking:

  • Confocal laser scanning microscopy (CLSM):

    • Using fluorescent protein fusions (GFP, mCherry, etc.)

    • Ensuring tags don't interfere with protein localization

    • Co-localization with Golgi markers (e.g., sialyltransferase)

    • Live cell imaging for trafficking studies

  • Super-resolution microscopy:

    • Structured illumination microscopy (SIM)

    • Stimulated emission depletion (STED) microscopy

    • Single-molecule localization microscopy (PALM/STORM)

    • Provides nanoscale resolution to better visualize Golgi localization

  • Transmission electron microscopy (TEM):

    • Immunogold labeling for precise localization

    • High-pressure freezing and freeze substitution for optimal preservation

    • Correlative light and electron microscopy (CLEM)

  • Advanced fluorescence techniques:

    • Fluorescence recovery after photobleaching (FRAP) to study protein mobility

    • Fluorescence resonance energy transfer (FRET) for interaction studies

    • Photoactivatable or photoconvertible fluorescent proteins for pulse-chase experiments

  • Sample preparation considerations:

    • Live cell imaging where possible

    • Careful fixation protocols to preserve membrane structure

    • Use of appropriate controls to validate localization patterns

What analytical methods should be used to characterize xyloglucan structures produced by CSLC2?

Comprehensive characterization of xyloglucan structures requires multiple analytical approaches:

  • Enzymatic digestion approaches:

    • Endo-β-1,4-glucanase treatment to release xyloglucan oligosaccharides

    • Specific xyloglucanases for structural analysis

    • Sequential enzymatic treatments to map substitution patterns

  • Chromatographic methods:

    • High-Performance Anion-Exchange Chromatography with Pulsed Amperometric Detection (HPAEC-PAD)

    • Size Exclusion Chromatography (SEC) for molecular weight determination

    • Reversed-phase HPLC for oligosaccharide profiling

  • Mass spectrometry techniques:

    • Matrix-Assisted Laser Desorption/Ionization (MALDI-MS)

    • Electrospray Ionization Mass Spectrometry (ESI-MS)

    • Tandem MS for linkage and sequence information

    • Ion-mobility MS for conformational analysis

  • NMR spectroscopy:

    • 1D and 2D NMR for detailed structural characterization

    • Determination of glycosidic linkages and substitution patterns

    • Analysis of conformational properties

  • Oligosaccharide labeling techniques:

    • Reductive amination with fluorescent labels

    • Permethylation for enhanced MS analysis

    • Isotopic labeling for NMR studies

  • Data analysis approaches:

    • Oligosaccharide fingerprinting

    • Structural database comparison

    • Integration of multiple analytical datasets

    • Computational modeling of structure-function relationships

These analytical methods can reveal the specific patterns of xylosylation (such as XGGGGG, XXGGGG, XXXGGG, and XXXXGG) that result from the coordinated action of CSLC2 and xylosyltransferases .

How can researchers accurately measure CSLC2 expression across different rice tissues and conditions?

Multiple complementary approaches can be used to measure CSLC2 expression:

  • Quantitative Real-Time PCR (qRT-PCR):

    • Design of specific primers for CSLC2

    • Selection of appropriate reference genes for normalization

    • Use of multiple biological and technical replicates

    • Application across diverse tissues and developmental stages

  • RNA-Sequencing (RNA-Seq):

    • Whole transcriptome analysis for comprehensive expression profiling

    • Differential expression analysis under various conditions

    • Co-expression network analysis to identify functionally related genes

    • Integration with other CESA/CSL family members' expression data

  • Microarray analysis:

    • Has been successfully used to analyze expression of CESA/CSL genes across 33 rice tissue samples throughout the entire life cycle

    • Enables comparative analysis between different rice varieties

  • Promoter-reporter constructs:

    • Fusion of CSLC2 promoter with reporter genes (GUS, LUC, fluorescent proteins)

    • Analysis of spatial and temporal expression patterns

    • Identification of regulatory elements through deletion analysis

  • Protein-level expression analysis:

    • Western blotting with specific antibodies

    • Immunohistochemistry for tissue localization

    • Proteomic approaches for quantitative analysis

  • Single-cell approaches:

    • Single-cell RNA-seq for cell-type specific expression analysis

    • Laser capture microdissection followed by expression analysis

What computational approaches can predict CSLC2 substrate specificity and catalytic properties?

Several computational approaches can provide insights into CSLC2 function:

  • Homology modeling and molecular dynamics:

    • Building 3D structural models based on related crystallized proteins

    • Simulating protein dynamics to understand conformational changes

    • Predicting substrate binding sites and catalytic residues

    • Modeling transmembrane regions and channel properties

  • Molecular docking:

    • Predicting interactions with UDP-glucose and acceptor substrates

    • Identifying key binding residues

    • Estimating binding energies and affinities

  • Quantum mechanics/molecular mechanics (QM/MM):

    • Modeling the reaction mechanism at atomic resolution

    • Calculating energy barriers for catalytic steps

    • Understanding the stereochemical outcome of the glycosyl transfer

  • Evolutionary analysis:

    • Identifying conserved residues through multiple sequence alignment

    • Detecting sites under positive or negative selection

    • Reconstructing ancestral sequences to understand functional evolution

  • Machine learning approaches:

    • Training models on known glycosyltransferase data

    • Predicting substrate preferences and reaction parameters

    • Identifying patterns in sequence-structure-function relationships

  • Systems biology integration:

    • Network analysis to understand functional context

    • Integration with expression data and co-expression networks

    • Predicting phenotypic consequences of mutations

These approaches can complement experimental data and provide hypotheses for experimental validation, particularly regarding how CSLC2's structure enables its function in synthesizing the β-(1→4)-glucan backbone of xyloglucan.

How do environmental stresses influence CSLC2 expression and activity in rice?

Environmental stresses may significantly impact CSLC2 expression and activity as part of the plant's adaptive response:

  • Transcriptional regulation:

    • Stress-responsive elements in the CSLC2 promoter may mediate expression changes

    • Transcription factors activated by stress signaling pathways can alter CSLC2 expression

    • Tissue-specific regulation may occur under stress conditions

  • Post-translational modifications:

    • Phosphorylation, glycosylation, or other modifications may alter CSLC2 activity

    • Stress-activated kinases may directly target CSLC2

    • Redox regulation might affect enzyme function under oxidative stress

  • Subcellular trafficking and localization:

    • Stress may alter CSLC2 trafficking to or within the Golgi apparatus

    • Changes in membrane composition under stress may affect enzyme function

    • Altered protein-protein interactions may influence activity or targeting

  • Substrate availability:

    • Metabolic changes under stress may affect UDP-glucose levels

    • Competition with other metabolic pathways for substrates

    • Changes in cellular energetics affecting enzymatic activity

  • Integration with stress responses:

    • Cell wall remodeling as part of drought or salt stress responses

    • Changes in cell expansion under various stresses requiring altered xyloglucan synthesis

    • Potential roles in biotic stress responses through cell wall reinforcement

While the specific response of CSLC2 to environmental stresses is not directly documented in the provided search results, studies of rice under salt stress have employed genome-wide association studies (GWAS) to identify genes involved in stress tolerance , suggesting similar approaches could be used to investigate CSLC2's role in stress responses.

How has CSLC2 evolved across different grass species and what functional implications does this have?

Evolutionary analysis of CSLC2 across grass species can provide insights into its functional importance and specialization:

  • Phylogenetic analysis:

    • Comparison of CSLC2 sequences across diverse grass species

    • Identification of conserved domains indicating functional importance

    • Detection of rapidly evolving regions that may indicate species-specific adaptations

    • Reconstruction of the evolutionary history of CSLC2 duplication events

  • Selective pressure analysis:

    • Calculation of Ka/Ks ratios to identify sites under positive or purifying selection

    • Identification of lineage-specific selection patterns

    • Correlation with functional domains and species-specific cell wall differences

  • Functional implications:

    • Conservation patterns may reveal critical catalytic and structural domains

    • Species-specific variations may correlate with differences in xyloglucan structure

    • Differences in expression patterns across species may indicate functional specialization

    • Correlation with cell wall compositional differences between grass species

  • Synteny analysis:

    • Examination of genomic context and gene neighborhood conservation

    • Identification of regulatory element conservation or divergence

    • Detection of genomic rearrangements affecting CSLC2 expression or function

  • Duplication history:

    • Analysis of tandem duplication events that have likely contributed to the expansion of Cluster I genes (potentially including CSLC2)

    • Assessment of functional diversification following duplication events

    • Comparison with segmental duplication patterns observed in Cluster II genes

What functional differences exist between CSLC enzymes in monocots versus dicots?

Significant differences exist in cell wall composition between monocots and dicots, which are reflected in their CESA/CSL gene families:

  • Compositional differences:

    • Monocot cell walls contain more mixed-linkage glucans and less pectin than dicot walls

    • Xyloglucan content and structure differ between the two plant groups

    • These differences necessitate specialized activities of cell wall biosynthetic enzymes

  • Genomic differences:

    • The rice CESA/CSL superfamily shows striking differences from Arabidopsis, reflecting distinct cell wall compositions

    • Gene duplication patterns differ, with evidence that Cluster I and II genes in rice expanded mainly through tandem and segmental duplication, respectively

  • Expression pattern differences:

    • Rice CESA genes show different expression patterns compared to their Arabidopsis counterparts

    • Some CSLC genes in rice show tissue-specific expression patterns, particularly in reproductive tissues (stamen) and root tissues (radicles)

  • Functional conservation:

    • Despite differences, several orthologs of Arabidopsis CSL genes exhibit similar functions in rice

    • This suggests a fundamental conservation of core enzymatic functions despite evolutionary divergence

  • Specialization:

    • Monocot-specific CSLC genes may have evolved specialized functions for grass-specific cell wall structures

    • Different regulatory networks may control CSLC expression in monocots versus dicots

Understanding these differences is crucial for translating research findings between model dicots like Arabidopsis and important monocot crops like rice. The specialized nature of cell wall biosynthesis in different plant groups necessitates specific study of CSLC2 in rice rather than simple extrapolation from dicot models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.