Recombinant Oryza sativa subsp. indica Putative magnesium transporter MRS2-H (MRS2-H)

Shipped with Ice Packs
In Stock

Description

General Information

MRS2-H is a putative magnesium transporter found in Oryza sativa subsp. indica (rice) . It is encoded by the gene MRS2-H and is also known as OsI_09927 . The full-length protein consists of 435 amino acids .

Table 1: MRS2-H Information

FeatureDescription
SpeciesOryza sativa subsp. indica (Rice)
Gene NameMRS2-H
SynonymsMRS2-H, OsI_09927, Putative magnesium transporter MRS2-H
Protein Length435 amino acids
Molecular WeightApproximately 49 kDa (estimated)
TagHis-tag (added for purification)
SourceE. coli
UniProt IDA2XCA0

Structure

MRS2 proteins, including MRS2-H, share structural similarities with the CorA-MRS2-ALR superfamily . Human MRS2 forms a pentameric channel architecture, as revealed by cryo-electron microscopy . Each subunit contains transmembrane helices that form a pore through which magnesium ions can pass .

Function

MRS2-H functions as a magnesium transporter, facilitating the uptake and distribution of magnesium within the plant . Magnesium is an essential nutrient for various cellular processes, including:

  • Chlorophyll synthesis

  • Enzyme activity

  • Mitochondrial function

  • Maintaining proper cellular Mg2+ homeostasis for mitochondrial integrity and function

MRS2-H, like other members of the MRS2/MGT family, plays a role in maintaining magnesium homeostasis within plant cells . Studies on Arabidopsis thaliana MRS2/MGT genes have shown that several members are expressed in root tissues, suggesting their involvement in magnesium supply and distribution .

Expression and Localization

Expression studies of MRS2/MGT genes in Arabidopsis thaliana have revealed tissue-specific expression patterns, with several members being expressed in root tissues . This suggests that MRS2-H is likely expressed in rice roots, where it contributes to magnesium uptake from the soil .

Research Findings

The Arabidopsis thaliana MRS2/MGT gene family has been studied using a mag-fura-2 system to measure magnesium uptake. This system allows for direct measurement of Mg2+ uptake into mitochondria of Saccharomyces cerevisiae . Studies have shown that different members of the Arabidopsis family complement the yeast mrs2 mutant, indicating their role in magnesium transport .

  • Mutations in the GMN motif can abolish Mg2+ transport or alter the ion selectivity of the channel .

  • Human MRS2 is a non-selective channel permeable to Mg2+, Ca2+, Na+, and K+ .

  • An arginine ring within the pore of human MRS2 restricts cation movements .

Related Products

Recombinant MRS2-H protein is available for research purposes from various commercial sources. These products are typically expressed in E. coli and tagged with a His-tag for purification . The recombinant protein can be used for various applications, including:

  • Antibody production

  • ELISA assays

  • Functional studies

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MRS2-H; OsI_09927; Putative magnesium transporter MRS2-H
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-435
Protein Length
full length protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
MRS2-H
Target Protein Sequence
MALPCAFLSAAAAANATSFSSSPESRRCRSVHRVPSRPRPPLAPPARVMGKGNSKRKAAN TRLWMRLDRRGGCEMILCDKSFVARRSGLPARDLRVLGPLLSRSPSILAREKAMVINLEF VRAIVTADEVLVLEPLAQEVLPFVEKLRKHFPLKSLDVDDVSTHMHTENQDGELAQDVSC YEVEGANHELPFEFQVLDFALEAVCLSYNSTISDLNRSAIAVLDDLMKSVSTRNLERVRS LKSSLTRLLASVQKVRDEVEHILDDNEAMAHLCTARKTKGQKDLLNTILFPETRLCRTHS SIENSTGIRTCVPSDSDAHILDMLLEAYFKQLDGIRNRIFLVRQYIVDTEDYISIQLDNK RNELLGLQLTLIIASFGIAINTFIAAAFAMNIPHRGYHFVIGVPFGQFVGATSFLCMSIV ILLFTYAWRNRLLCT
Uniprot No.

Target Background

Function
Putative magnesium transporter.
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35.5) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is MRS2-H and its functional role in Oryza sativa?

MRS2-H (A2XCA0) is a putative magnesium transporter belonging to the MRS2/MGT gene family in rice. This 435-amino acid protein is characterized as a member of the CorA-MRS2-ALR-type membrane proteins, which feature a distinctive GMN tripeptide motif (Gly-Met-Asn) at the end of the first of two C-terminal transmembrane domains . The primary function of MRS2-H is magnesium transport across biological membranes, likely playing a crucial role in magnesium homeostasis in rice. Based on studies of the MRS2/MGT family in other plants, MRS2-H is expected to be involved in plant magnesium supply and distribution, particularly after uptake from soil substrates .

How does the structure of MRS2-H compare to other characterized MRS2 family members?

While the specific structure of rice MRS2-H has not been fully resolved, insights can be gained from related proteins. MRS2 proteins typically form pentameric channels in membranes with unique magnesium binding sites. The human MRS2 structure reveals an ion channel with multiple binding sites, including a unique interfacial Mg²⁺ binding site (site 3) generated by an acidic pocket at the inter-subunit interface . The rice MRS2-H likely shares structural features with other family members, including transmembrane domains and the characteristic GMN motif essential for ion selectivity. The full amino acid sequence of rice MRS2-H (available from search results) reveals potential structural domains that could be aligned with better-characterized MRS2 proteins to predict functional regions .

What tissue-specific expression patterns are expected for MRS2-H in rice plants?

Based on studies of the MRS2/MGT family in Arabidopsis, different family members show highly variable tissue-specific expression patterns . Six of the ten Arabidopsis MRS2/MGT family members are expressed in root tissues, suggesting involvement in magnesium uptake from soil and subsequent distribution throughout the plant . Though rice-specific expression data for MRS2-H is limited in the search results, researchers can investigate its expression pattern using techniques similar to those employed for Arabidopsis, such as promoter-GUS fusion studies to visualize tissue-specific expression .

What expression systems are optimal for producing recombinant MRS2-H?

Multiple expression systems can be used to produce recombinant MRS2-H, each with distinct advantages:

  • E. coli expression: Offers the best yields and shorter turnaround times, making it suitable for initial characterization studies . The protein can be expressed with an N-terminal His-tag to facilitate purification .

  • Yeast expression: Also provides good yields with relatively quick production times, and may offer some post-translational modifications not present in bacterial systems .

  • Insect cells with baculovirus: Provides more complex post-translational modifications that might be necessary for proper protein folding and function .

  • Mammalian cell expression: Offers the most complete post-translational modifications, potentially critical for retaining full protein activity .

For initial functional studies, E. coli expression systems have been successfully used with other MRS2 family members. For instance, the mag-fura-2 system for measuring magnesium uptake has been established using heterologous expression in yeast .

What purification strategies should be employed for recombinant MRS2-H?

The recommended purification strategy for His-tagged MRS2-H includes:

  • Affinity chromatography: Using Ni-NTA or similar matrices to capture the His-tagged protein.

  • Buffer optimization: The storage buffer reported for commercially available recombinant MRS2-H is Tris/PBS-based with 6% trehalose at pH 8.0 .

  • Storage considerations: Lyophilized powder form is stable, but once reconstituted, it should be stored properly with glycerol added to a final concentration of 5-50% (with 50% being the default recommendation) and aliquoted for long-term storage at -20°C/-80°C .

  • Reconstitution protocol: The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Avoiding degradation: Repeated freeze-thaw cycles should be avoided; working aliquots can be stored at 4°C for up to one week .

How can I verify the magnesium transport activity of recombinant MRS2-H?

To verify the magnesium transport activity of MRS2-H, researchers can adapt several established methods:

  • Mag-fura-2 fluorescence assays: This system allows direct measurement of Mg²⁺ uptake in real-time across biological membranes. It has been successfully used with other MRS2 family members expressed in yeast mitochondria . The fluorescent dye mag-fura-2 changes its emission properties upon binding Mg²⁺, allowing quantification of transport activity.

  • Complementation assays: Testing whether MRS2-H can complement yeast mrs2 mutants provides functional evidence of magnesium transport. Growth assays over hours can detect even slow transporters that might not show measurable activity in shorter uptake experiments .

  • Electrophysiological measurements: For more detailed kinetic studies, patch-clamp techniques could potentially be adapted to study MRS2-H channel properties in artificial membranes or expression systems.

What approaches are recommended for studying MRS2-H in the context of rice magnesium homeostasis?

To investigate MRS2-H's role in rice magnesium homeostasis, several comprehensive approaches are recommended:

  • Transgenic studies: Developing overexpression lines and knockdown/knockout mutants of MRS2-H in rice. This approach has been successfully used for other transporters in rice, such as the work with CRY2 in indica rice where overexpression transgenics were generated to study phenotypic effects .

  • Tissue-specific expression analysis: Using techniques like qRT-PCR, in situ hybridization, or promoter-reporter fusions to determine where and when MRS2-H is expressed in rice plants under different magnesium conditions.

  • Physiological phenotyping: Analyzing how altered MRS2-H expression affects growth, development, and stress responses in rice, particularly under varying magnesium concentrations.

  • Whole-genome transcriptome profiling: Investigating how MRS2-H affects the expression of other genes involved in mineral homeostasis, similar to the transcriptome analysis performed for CRY2 overexpression in rice .

  • Mineral content analysis: Quantifying magnesium and other mineral contents in different tissues of plants with altered MRS2-H expression levels.

How can CRISPR-Cas9 technology be employed to study MRS2-H function in rice?

CRISPR-Cas9 genome editing offers powerful approaches to investigate MRS2-H function:

  • Gene knockout: Creating complete loss-of-function mutants by introducing frameshift mutations in coding regions.

  • Domain-specific mutations: Targeting specific domains, such as the GMN motif or transmembrane regions, to study their functional importance.

  • Promoter editing: Modifying regulatory regions to alter expression patterns without changing the protein sequence.

  • Tagging strategies: Adding fluorescent or epitope tags to the endogenous gene for localization and interaction studies.

  • Multiplexed editing: Targeting multiple MRS2 family members simultaneously to address potential functional redundancy.

When designing CRISPR experiments, researchers should consider using rice protoplast systems for initial validation of guide RNAs before proceeding to stable transformation. The efficiency of genome editing and the phenotypic characterization should include comprehensive magnesium transport assays and growth analyses under varying magnesium conditions.

What are the predicted key functional domains in MRS2-H and how can they be experimentally validated?

Based on homology with other MRS2 family members, key functional domains in MRS2-H likely include:

  • GMN motif: This highly conserved tripeptide (Gly-Met-Asn) at the end of the first C-terminal transmembrane domain is critical for ion selectivity in the MRS2/MGT family .

  • Transmembrane domains: The protein contains transmembrane regions that form the channel pore.

  • Mg²⁺ binding sites: Multiple binding sites are likely present, potentially including an interfacial binding site formed by acidic residues from adjacent subunits, as observed in human MRS2 .

  • N-terminal regulatory domain: This region may be involved in sensing magnesium levels and regulating channel activity.

These domains can be experimentally validated through:

  • Site-directed mutagenesis: Systematically altering key residues and assessing the impact on transport activity.

  • Domain swapping: Exchanging domains between MRS2-H and other MRS2 family members to determine functional specificity.

  • Limited proteolysis: Identifying stable protein domains resistant to proteolytic digestion.

  • Crosslinking studies: Identifying residues involved in subunit interactions within the pentameric channel.

How does MRS2-H from Oryza sativa indica compare to orthologs in other plant species?

MRS2-H from Oryza sativa indica can be compared to orthologs in other plant species through several analytical approaches:

What bioinformatic tools and databases are most useful for analyzing MRS2-H and related transporters?

For comprehensive analysis of MRS2-H and related transporters, researchers should utilize:

  • Sequence databases:

    • UniProt (A2XCA0 for MRS2-H)

    • NCBI Protein

    • Rice Genome Annotation Project

  • Structural prediction tools:

    • AlphaFold (mentioned as useful for human MRS2 structural studies)

    • SWISS-MODEL

    • I-TASSER

    • TMHMM for transmembrane domain prediction

  • Functional annotation tools:

    • InterPro for domain identification

    • Pfam for protein family classification

    • PANTHER for evolutionary relationships

  • Expression databases:

    • Rice Expression Database

    • NCBI GEO

    • Expression Atlas

  • Comparative genomics resources:

    • Gramene for cereal genomes comparison

    • Phytozome for plant comparative genomics

    • Plaza for plant comparative genomics

  • Visualization tools:

    • PyMOL or UCSF Chimera for structural visualization

    • Jalview for sequence alignment visualization

    • Interactive Tree Of Life (iTOL) for phylogenetic tree visualization

How can transcriptomic data be integrated with protein function studies of MRS2-H?

Integrating transcriptomic data with MRS2-H functional studies provides a systems-level understanding of magnesium transport in rice. This approach can be implemented through:

  • Condition-specific expression profiling: Analyzing MRS2-H expression under varying magnesium conditions, developmental stages, and stress treatments to identify regulatory patterns. This approach has been successful in studying other transporters in rice, such as the transcriptome profiling of rice CRY2 overexpression lines .

  • Co-expression network analysis: Identifying genes with expression patterns correlated with MRS2-H to reveal functional associations and regulatory networks.

  • Comparative transcriptomics: Comparing transcriptional responses between wild-type and MRS2-H mutant/overexpression lines to identify downstream effects of altered magnesium transport.

  • Integration with phenotypic data: Correlating expression data with physiological phenotypes, similar to how researchers analyzed how CRY2 overexpression affected plant height and flowering in rice .

  • Multi-omics integration: Combining transcriptomics with proteomics and metabolomics data to build comprehensive models of magnesium homeostasis pathways in rice.

What experimental designs are appropriate for studying MRS2-H function under variable environmental conditions?

To study MRS2-H function under different environmental conditions, researchers should consider:

  • Factorial experimental designs: Testing multiple factors simultaneously, such as:

    • Magnesium availability (deficient, optimal, excess)

    • Other mineral nutrients that may interact with magnesium uptake

    • Abiotic stresses (drought, salinity, temperature)

    • Light conditions (which might affect mineral transport)

  • Time-course experiments: Monitoring MRS2-H expression and magnesium content over developmental stages and during stress responses.

  • Field vs. controlled environment studies: Comparing MRS2-H function in controlled growth chambers versus field conditions to assess environmental interactions.

  • Soil and hydroponic system comparisons: Evaluating MRS2-H function in different growth media to understand substrate effects on magnesium uptake.

  • Genotype-environment interactions: Testing MRS2-H variants across different rice varieties to identify genetic background effects.

An example experimental design might include:

TreatmentMg LevelStress ConditionTimepointsMeasurements
ControlOptimal (1mM)None7, 14, 21 daysGene expression, protein levels, Mg content, growth parameters
Mg DeficiencyLow (0.01mM)None7, 14, 21 daysGene expression, protein levels, Mg content, growth parameters
Mg ExcessHigh (10mM)None7, 14, 21 daysGene expression, protein levels, Mg content, growth parameters
Drought + Optimal MgOptimal (1mM)50% field capacity7, 14, 21 daysGene expression, protein levels, Mg content, growth parameters
Salinity + Optimal MgOptimal (1mM)100mM NaCl7, 14, 21 daysGene expression, protein levels, Mg content, growth parameters

This approach would provide comprehensive insights into MRS2-H function across variable conditions while controlling for potential confounding factors.

How might genetic variation in MRS2-H contribute to magnesium efficiency traits in rice varieties?

Genetic variation in MRS2-H may significantly impact magnesium efficiency in rice through several mechanisms:

Identifying beneficial MRS2-H variants could inform breeding programs targeting improved magnesium use efficiency, which is particularly important for rice cultivation in magnesium-deficient soils. Modern sequencing approaches combined with phenotyping for magnesium efficiency traits could reveal valuable genetic resources for crop improvement.

What genome editing strategies could be employed to enhance MRS2-H function for improved magnesium use efficiency?

Several genome editing strategies could potentially enhance MRS2-H function for improved magnesium use efficiency in rice:

  • Promoter editing: Modifying the MRS2-H promoter to increase expression levels or alter tissue-specific patterns for enhanced magnesium uptake.

  • Coding sequence optimization: Targeted modifications to improve transport kinetics or ion selectivity based on structure-function studies of MRS2 proteins.

  • Regulatory element modification: Editing cis-regulatory elements to make MRS2-H expression responsive to magnesium deficiency conditions.

  • Allele replacement: Replacing the native MRS2-H with superior alleles identified from diverse germplasm or designed based on structural insights.

  • Multiplex editing: Targeting multiple magnesium transporters simultaneously to create an optimized magnesium transport network.

Implementation considerations include:

  • Off-target effects assessment

  • Phenotypic evaluation under varying magnesium conditions

  • Field testing across diverse environments

  • Integration with conventional breeding programs

The editing approach should be guided by a thorough understanding of MRS2-H structure-function relationships and its role in whole-plant magnesium homeostasis.

What are common difficulties encountered when working with recombinant MRS2-H and how can they be addressed?

Researchers working with recombinant MRS2-H may encounter several challenges:

  • Low expression levels: Membrane proteins often express poorly in heterologous systems.

    • Solution: Optimize codon usage for the expression host, use fusion partners like BRIL (as done with human MRS2) , or try different expression systems .

  • Protein insolubility: Membrane proteins tend to aggregate when overexpressed.

    • Solution: Adjust induction conditions (temperature, inducer concentration), use specific detergents for solubilization, or employ membrane-mimetic systems.

  • Protein instability: Purified MRS2-H may rapidly lose activity.

    • Solution: Include stabilizing agents like trehalose (6%) in storage buffers , add glycerol (5-50%) for long-term storage, and avoid repeated freeze-thaw cycles .

  • Functional assays challenges: Detecting magnesium transport activity can be technically demanding.

    • Solution: Use established systems like mag-fura-2 fluorescence assays , complement with growth-based assays in transport-deficient yeast strains .

  • Post-translational modification issues: Bacterial expression systems lack eukaryotic modifications.

    • Solution: Consider expression in yeast, insect, or mammalian cells if post-translational modifications are critical for function .

How can inconsistent results between different functional assays for MRS2-H be reconciled?

When faced with inconsistent results between different functional assays for MRS2-H:

  • Understand assay limitations: Different assays measure different aspects of transporter function. For example, growth complementation assays in yeast mutants measure long-term transport sufficiency, while mag-fura-2 fluorescence assays measure real-time transport kinetics . Such differences might explain why MRS2-3 in Arabidopsis showed good complementation in growth assays but minimal transport in uptake experiments .

  • Consider time scales: Some transporters may function slowly but sufficiently for biological processes. Assays conducted over minutes (like mag-fura-2) versus hours/days (like growth assays) may yield different results .

  • Assess protein expression and localization: Verify that the protein is correctly expressed, folded, and localized in each experimental system. Western blotting with anti-tag antibodies and subcellular fractionation can confirm proper expression and targeting.

  • Control for experimental conditions: Ensure that buffer compositions, pH, temperature, and other experimental parameters are consistent and physiologically relevant.

  • Use multiple complementary approaches: Combine different assay types (biophysical, genetic, physiological) to build a comprehensive understanding of transporter function.

  • Develop appropriate statistical analyses: Apply statistical methods suitable for the specific assay type and data distribution to properly interpret results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.