Recombinant Oryza sativa subsp. indica Putative secretory carrier-associated membrane protein 1 (SCAMP1)

Shipped with Ice Packs
In Stock

Description

Functional Insights

SCAMP1 localizes to the plasma membrane and early endosomal compartments, facilitating endocytosis and cargo sorting . Key findings include:

  • Subcellular Localization: Tagged SCAMP1 in transgenic tobacco BY-2 cells labels clathrin-coated, trans-Golgi–located tubular-vesicular structures, identified as early endosomes .

  • Dynamic Trafficking: Internalized endocytic markers (e.g., FM4-64) reach SCAMP1-positive compartments before prevacuolar compartments (PVCs), confirming its role in early endosomal sorting .

  • Wortmannin Sensitivity: The antifungal agent wortmannin redistributes SCAMP1 from early endosomes to PVCs, suggesting compartment fusion under stress .

Production and Purification

The recombinant protein is produced under optimized conditions:

ParameterSpecification
Expression HostEscherichia coli
TagN-terminal His
Purity>90% (SDS-PAGE verified)
FormLyophilized powder in Tris/PBS buffer (pH 8.0)
Storage-20°C/-80°C; avoid freeze-thaw cycles
Reconstitution0.1–1.0 mg/mL in sterile water + 5–50% glycerol

Research Applications

SCAMP1 has been pivotal in elucidating plant endocytic pathways:

  • Mechanistic Studies: Used to map interactions between clathrin-coated vesicles and trans-Golgi networks .

  • Comparative Biology: Homologs in Arabidopsis and mammals share conserved trafficking roles, aiding cross-species functional analyses .

  • Drug Response Assays: Investigates compartmental responses to inhibitors like wortmannin .

Amino Acid Sequence Highlights

  • Molecular Weight: ~37 kDa (calculated from 306 residues) .

  • Functional Motifs: NPF repeats (e.g., NPF motifs at cytosolic N terminus) mediate epsin-homology domain interactions .

Validation Methods

  • Confocal immunofluorescence and immunogold electron microscopy confirm localization .

  • Antibody specificity verified via Western blot and overexpression assays .

Broader Implications

SCAMP1’s conservation across plants and animals underscores its fundamental role in membrane trafficking. Its recombinant form enables targeted studies on crop productivity and stress adaptation, with potential applications in improving nutrient uptake or pathogen resistance in rice .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request if possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate this with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SCAMP1; OsI_025590; Putative secretory carrier-associated membrane protein 1; Secretory carrier membrane protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
full length protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
SCAMP1
Target Protein Sequence
MAGRYDSNPFEEDDVNPFSEQARGKAGGQPSYGGGAFYMPNPRNVPSMSSNSRLSPLPPE PAAFGATVDIPLDSSKDLKNREKELQAREAELNKREKELKRREEAAARAGIVIEEKNWPP FLPLIHHDITNEIPSHLQRMQYVAFASFLGLACCLFWNVIAVTSAWVKGEGVKIWLLAII YFISGVPGAYVLWYRPLYNAMRTDSALKFGLFFLVYLFHILFCVFSAVAPPVVFEGKSLA GILPAIDLISKNALVGIFYFVGFGLFCVESLLSIWVIQQVYMYFRGSGKAAEMKRDATRG AMRAAF
Uniprot No.

Target Background

Function
This protein is likely involved in membrane trafficking.
Database Links
Protein Families
SCAMP family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle, secretory vesicle membrane; Multi-pass membrane protein.

Q&A

What cellular compartments are associated with rice SCAMP1?

Rice SCAMP1 localizes primarily to the plasma membrane and mobile structures in the cytoplasm. Immunogold electron microscopy with high-pressure frozen/freeze-substituted samples has identified SCAMP1-positive organelles as tubular-vesicular structures at the trans-Golgi with clathrin coats . These structures appear to function as early endosomes in the plant endocytic pathway, resembling the previously described partially coated reticulum and trans-Golgi network in plant cells .

How does rice SCAMP1 compare to SCAMP proteins in other organisms?

Rice SCAMP1 shows structural and functional homology to SCAMP proteins found across diverse organisms, including Arabidopsis thaliana, Drosophila melanogaster, and Mus musculus . Sequence analysis reveals that SCAMPs are evolutionarily conserved from plants to animals, suggesting fundamental roles in membrane trafficking. While animal SCAMPs mediate endocytosis, plant SCAMPs like rice SCAMP1 appear to play similar roles in the endocytic pathway but with plant-specific adaptations related to the unique architecture of plant cells .

What are the optimal conditions for reconstituting recombinant rice SCAMP1 protein?

For optimal reconstitution of lyophilized recombinant rice SCAMP1:

  • Briefly centrifuge the vial containing lyophilized protein before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended as default)

  • Aliquot for long-term storage at -20°C/-80°C

Important precautions include avoiding repeated freeze-thaw cycles and storing working aliquots at 4°C for no more than one week .

How can I efficiently express recombinant rice SCAMP1 for structural studies?

To express recombinant rice SCAMP1:

  • Clone the full-length coding sequence (1-306 aa) into an appropriate expression vector with an N-terminal His tag

  • Transform E. coli expression strains (BL21 DE3 or similar protease-deficient strains are recommended)

  • Induce protein expression with 1 mM IPTG for approximately 2 hours

  • Harvest cells and lyse in Tris buffer (pH 8.0) containing protease inhibitors:

    • 1 mM PMSF

    • 1 mM 4-(2-aminoethyl)benzenesulfonylfluoride

    • 100 μM leupeptin

    • 2 mM EDTA

  • Purify using standard His-tag affinity chromatography methods

  • Verify purity by SDS-PAGE (should be >90% pure)

What techniques can be used to study SCAMP1 localization in plant cells?

Multiple complementary approaches can be employed:

TechniqueApplicationResolutionAdvantages
Confocal immunofluorescenceLive-cell imagingSubcellularAllows visualization of dynamic processes
YFP fusion proteinsTracking in vivoSubcellularNon-invasive visualization of trafficking
Immunogold electron microscopyUltrastructural analysisNanometerPrecise localization within compartments
Drug treatments (e.g., wortmannin)Pathway disruptionFunctionalReveals trafficking relationships
Endocytic markers (FM4-64, AM4-64)Pathway tracingTemporalShows sequential compartment relationships

For optimal results, implement high-pressure freezing/freeze-substitution methods for electron microscopy sample preparation to preserve native membrane architecture .

How can I investigate the role of rice SCAMP1 in endocytic trafficking pathways?

To determine SCAMP1's role in endocytic trafficking:

  • Generate transgenic plant cells expressing fluorescent protein-tagged SCAMP1 (YFP-SCAMP1 or SCAMP1-YFP constructs)

  • Perform time-course experiments with fluorescent endocytic markers (FM4-64, AM4-64)

  • Analyze co-localization patterns to establish temporal relationships between compartments

  • Apply endocytosis inhibitors or pathway disruptors (e.g., wortmannin, which causes redistribution of SCAMP1 from early endosomes to PVCs)

  • Conduct FRAP (Fluorescence Recovery After Photobleaching) experiments to measure protein mobility and membrane dynamics

  • Implement live-cell imaging to track movements of SCAMP1-positive structures

This multi-faceted approach reveals that SCAMP1-labeled organelles serve as early endosomes, as demonstrated by their receiving internalized endocytic markers before prevacuolar compartments .

What are the critical steps in analyzing SCAMP1 membrane topology?

To accurately map SCAMP1 membrane topology:

  • Employ limited proteolysis with intact organelles to identify exposed domains

    • Use isolated secretory granules as a uniformly oriented source of antigen

    • Apply controlled trypsin digestion followed by immunoblotting to track progressive degradation from N and C termini

  • Create alkaline phosphatase gene fusions for topology mapping

    • Generate fusion constructs at various positions along the SCAMP1 sequence

    • Express in E. coli and assess enzyme activity, which depends on periplasmic localization

  • Evaluate amphiphilic segment membrane interactions

    • Synthesize peptides corresponding to the conserved amphiphilic segments

    • Measure binding to phospholipid membranes

    • Perform circular dichroism spectroscopy to determine secondary structure (the central segment linking transmembrane spans 2 and 3 adopts an α-helical conformation)

These approaches collectively reveal a four-transmembrane topology with specific interfacial elements critical for function .

How can I distinguish between rice SCAMP1-positive early endosomes and other endomembrane compartments?

Rigorous differentiation of SCAMP1-positive early endosomes requires a combination of approaches:

  • Marker protein co-localization analysis:

    • Test against known Golgi markers (minimal overlap expected)

    • Test against prevacuolar compartment markers (distinct distribution)

    • Track progression of endocytic tracers (should reach SCAMP1 compartments before PVCs)

  • Morphological characterization:

    • Immunogold electron microscopy with high-pressure frozen/freeze-substituted samples

    • Identification of clathrin coats on tubular-vesicular structures at the trans-Golgi

    • Analysis of membrane curvature and lumenal content

  • Pharmacological interventions:

    • Wortmannin treatment (causes redistribution from early endosomes to PVCs)

    • Brefeldin A sensitivity testing

    • Cytoskeletal disruption agents to assess movement dependencies

The combined data should reveal a distinct compartment with unique biochemical, morphological, and functional properties at the interface between the trans-Golgi and later endocytic structures .

What are common issues with recombinant rice SCAMP1 stability and how can they be addressed?

Common stability challenges with recombinant SCAMP1 include:

IssueCauseSolution
Protein degradationProteolytic activityAdd comprehensive protease inhibitor cocktail including PMSF (0.25 mM), 4-(2-aminoethyl)benzenesulfonylfluoride (1 mM), leupeptin (100 μM), and EDTA (2 mM)
Activity loss during storageFreeze-thaw damageAvoid repeated freeze-thaw cycles; store working aliquots at 4°C for up to one week
Aggregation after reconstitutionImproper buffer conditionsReconstitute in appropriate buffer (Tris/PBS-based buffer with 6% Trehalose, pH 8.0); add glycerol (5-50%) for stability
Poor solubilityHydrophobic transmembrane domainsConsider using mild detergents for solubilization; for structural studies, explore membrane mimetics like nanodiscs or amphipols
Inconsistent yieldExpression variabilityOptimize E. coli growth conditions, induction timing, and temperature (typically 2-hour induction with 1 mM IPTG)

Implementing these solutions can significantly improve protein stability and experimental reproducibility .

How can I verify the functionality of recombinant rice SCAMP1 after purification?

To confirm recombinant SCAMP1 functionality:

  • Structural integrity assessment:

    • SDS-PAGE and Western blotting to verify size and immunoreactivity

    • Circular dichroism to examine secondary structure elements

    • Limited proteolysis to confirm proper folding (should yield expected fragment pattern)

  • Membrane binding assays:

    • Liposome binding tests for amphiphilic segments

    • Reconstitution into artificial membrane systems

  • Functional reconstitution:

    • Incorporation into proteoliposomes for transport studies

    • Complementation of SCAMP-deficient systems

  • Cell-based assays:

    • Transfection into plant cells and assessment of proper localization

    • Rescue of phenotypes in SCAMP1-deficient backgrounds

    • Co-immunoprecipitation to verify expected protein-protein interactions

Each approach provides different evidence for proper folding and function, with complementary strengths and limitations .

What strategies can help resolve difficulties in detecting rice SCAMP1 in immunological assays?

When facing challenges in SCAMP1 immunodetection:

  • Epitope accessibility optimization:

    • Test multiple fixation protocols (paraformaldehyde, glutaraldehyde, methanol)

    • Implement antigen retrieval methods where appropriate

    • Consider membrane permeabilization conditions (Triton X-100, saponin, digitonin) tailored to preserve structure

  • Antibody selection considerations:

    • Generate antibodies against multiple domains (N-terminal, C-terminal, loop regions)

    • Use peptide competition assays to confirm specificity

    • Consider monoclonal antibodies for consistent results

  • Signal enhancement approaches:

    • Implement tyramide signal amplification for immunofluorescence

    • Use enhanced chemiluminescence for Western blotting

    • Consider epitope-tagged versions (His-tag) for detection with commercial antibodies

  • Background reduction strategies:

    • Extended blocking with 5% non-fat milk or BSA

    • Pre-adsorption of antibodies with non-specific proteins

    • Use of highly specific secondary antibodies with minimal cross-reactivity

These methodological refinements can substantially improve detection sensitivity and specificity in both microscopy and biochemical applications .

How do rice SCAMP1 structure and function compare to SCAMPs in other plant species?

Rice SCAMP1 shares significant structural and functional features with SCAMPs from other plant species, particularly Arabidopsis thaliana:

  • Sequence conservation analysis:

    • Core transmembrane domains show highest conservation

    • N-terminal and C-terminal cytoplasmic domains display more variation

    • Amphiphilic segments maintain conserved physicochemical properties despite sequence differences

  • Functional conservation:

    • Both rice and Arabidopsis SCAMPs localize to early endosomal compartments

    • Both associate with clathrin-coated structures

    • Both participate in endocytic trafficking pathways

  • Species-specific adaptations:

    • Rice SCAMP1 may have specialized functions related to cereal-specific membrane trafficking requirements

    • Expression patterns may differ in response to developmental or environmental cues

Comprehensive comparison of rice and Arabidopsis SCAMPs provides insights into both fundamental SCAMP functions and species-specific adaptations in membrane trafficking systems .

What evolutionary insights can be gained from studying rice SCAMP1?

Evolutionary analysis of rice SCAMP1 reveals:

  • Deep conservation of SCAMP structure across eukaryotes:

    • Presence in diverse organisms from plants to animals indicates ancient origin

    • Core transmembrane topology and key functional domains preserved throughout evolution

    • Suggests fundamental role in eukaryotic membrane organization

  • Plant-specific adaptations:

    • Specialized functions related to plant cell architecture

    • Adaptations to plant-specific endomembrane organization

    • Potential roles in plant-specific processes (cell wall formation, defense responses)

  • Rice-specific features:

    • Integration with cereal-specific trafficking pathways

    • Potential involvement in specialized secretion related to seed storage proteins

  • Evolutionary rates:

    • Transmembrane domains evolve more slowly than cytosolic regions

    • Functional interfaces show stronger conservation than non-interface regions

These evolutionary patterns highlight both the fundamental importance of SCAMP proteins and their adaptation to species-specific cellular requirements .

What emerging technologies could advance our understanding of rice SCAMP1 function?

Cutting-edge approaches for SCAMP1 research include:

  • Advanced imaging technologies:

    • Super-resolution microscopy (STORM, PALM) to resolve nanoscale organization

    • Correlative light and electron microscopy for linking dynamics to ultrastructure

    • Light sheet microscopy for long-term imaging with minimal photodamage

    • Single-molecule tracking for analyzing diffusion and interaction dynamics

  • Genome editing approaches:

    • CRISPR/Cas9-mediated knockout, knockdown, or tagging of endogenous SCAMP1

    • Creation of functional domain mutants to dissect specific activities

    • Optogenetic control of SCAMP1 function for temporal precision

  • Proteomics and interactomics:

    • Proximity labeling (BioID, APEX) to identify context-specific interaction partners

    • Quantitative proteomics to analyze SCAMP1-dependent protein trafficking

    • Cross-linking mass spectrometry to capture transient interactions

  • Structural biology:

    • Cryo-electron microscopy of SCAMP1 in native membrane environments

    • Integrated structural approaches combining X-ray crystallography, NMR, and computational modeling

    • In situ structural determination using cellular tomography

These approaches promise to reveal new dimensions of SCAMP1 function in membrane trafficking and organization .

How might rice SCAMP1 be involved in stress responses and agricultural applications?

Potential roles of SCAMP1 in stress biology and agriculture:

  • Abiotic stress responses:

    • Membrane remodeling during osmotic stress

    • Trafficking of ion transporters during salt stress

    • Redistribution of aquaporins during drought

    • Analysis of SCAMP1 expression and localization under various stress conditions could reveal specific adaptive functions

  • Biotic stress interactions:

    • Potential roles in secretion of antimicrobial compounds

    • Involvement in receptor endocytosis during pathogen perception

    • Contribution to cell wall reinforcement during defense responses

  • Agricultural applications:

    • Engineering SCAMP1 expression or activity to enhance stress tolerance

    • Modifying membrane trafficking to improve nutrient use efficiency

    • Targeting SCAMP1-dependent pathways to enhance desirable traits

  • Research questions to address:

    • Does SCAMP1 expression or localization change under specific stress conditions?

    • Can SCAMP1 modifications alter plant responses to environmental challenges?

    • Are there natural SCAMP1 variants associated with stress tolerance in rice germplasm?

Understanding these connections could open new avenues for crop improvement strategies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.