Recombinant Oryza sativa subsp. indica Putative UPF0496 protein 2 (OsI_023618)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
OsI_023618; Putative UPF0496 protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-408
Protein Length
full length protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
OsI_023618
Target Protein Sequence
MIERSNSTPSATPVRPPLAVDEEYNQAFRSKSFLDLWSHAHHHLTHTFSSFKLSTSTPCA GRGGAREDDFLHAGGDGGAADDSEQSCSYTVLDDFVLEPSPESLARGARLQQRRRRRPRR HRVETLLIEYFDVTEEACEACSALLAAIGAARRHHLTLRRLLLRLDGGDDDDAKDALARH VRLDNPLSPGSLSEFHDVHARCSPLASRLAAAQRRLRRLARALRIARGTAAAALVGACAA AIVAAVVLAAHALVGIGVAAAAFGATPAGAARWWARRAAEKVSSRHYARAGATLDAAARG AYIVGRDLDTVSRMVRRAHDELEHGRDVARIAMRGHGERPLLQEVAREEEECEEDLRAQL AELEEHVCLCLITINRTRRLVAHEMARGLPPPSPATVTTTSEERLTSS
Uniprot No.

Target Background

Protein Families
UPF0496 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What are the optimal conditions for recombinant expression of OsI_023618?

E. coli has been successfully used as an expression system for OsI_023618 with N-terminal His-tagging . Based on studies with similar recombinant proteins, the following optimization parameters are recommended:

ParameterRecommended ConditionNotes
Expression systemE. coli BL21(DE3)Alternative strains: Rosetta 2, Arctic Express
Expression vectorpET-28aContains T7 promoter and His-tag
Induction temperature18-20°CLower temperatures improve solubility
IPTG concentration0.5 mMHigher concentrations may lead to inclusion bodies
Induction duration16-18 hoursExtended time improves yield for difficult proteins
OD600 at induction0.6-0.8Mid-log phase optimizes expression

For challenging expression cases, vector optimization by adding regulatory elements like Kozak and Leader sequences upstream of the target gene has shown significant improvement in recombinant protein expression levels . Recent studies demonstrate that CHO cells can also be used as an alternative expression system, especially when post-translational modifications are critical .

What purification strategy yields the highest purity for recombinant OsI_023618?

A multi-step purification process is recommended for achieving research-grade purity:

  • IMAC (Ni-NTA) chromatography: Using the N-terminal His-tag with imidazole gradient (20-250 mM) for elution

  • Size exclusion chromatography: To remove aggregates and misfolded species

  • Optional ion exchange: If higher purity is required

This approach typically yields >90% purity as determined by SDS-PAGE . For critical applications, adding an additional polishing step with ion exchange chromatography can increase purity to >95%.

Purification StepBuffer CompositionPurpose
Lysis50 mM Tris pH 8.0, 300 mM NaCl, 10 mM imidazole, 1 mM PMSF, 5% glycerolCell disruption while maintaining protein stability
IMAC Binding50 mM Tris pH 8.0, 300 mM NaCl, 20 mM imidazoleLow imidazole reduces non-specific binding
IMAC Elution50 mM Tris pH 8.0, 300 mM NaCl, 250 mM imidazoleCompetitive elution of His-tagged protein
Size Exclusion50 mM Tris pH 8.0, 150 mM NaClSeparates based on molecular size
Final StorageTris/PBS-based buffer, 6% trehalose, pH 8.0Stabilizes protein for long-term storage

How should purified recombinant OsI_023618 be stored for maximum stability?

Based on specifications from commercial suppliers , OsI_023618 should be stored as follows:

Storage ConditionRecommendationDuration
Short-term storage4°CUp to 1 week
Medium-term storage-20°CUp to 6 months
Long-term storage-80°C>6 months
Buffer compositionTris/PBS-based buffer, 6% trehalose, pH 8.0Maintains stability
Recommended additives50% glycerol for frozen storagePrevents freeze-thaw damage
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mLFor lyophilized protein
AliquotingRecommended to avoid freeze-thaw cyclesPrevents degradation

Repeated freezing and thawing is not recommended as it can lead to protein aggregation and loss of activity . The lyophilized form exhibits greater stability than solution and should be preferred for long-term storage whenever possible.

What is the current understanding of OsI_023618 function in rice?

While the specific function of OsI_023618 remains under investigation, studies of related proteins provide valuable insights:

  • Genome-wide analysis of rice proteins has identified differential expression patterns under salinity stress conditions .

  • Expression analysis of PHD finger family genes (which share similar regulatory patterns with UPF0496 proteins) showed upregulation of certain members (OsPHD6 and OsPHD12) under salinity stress, suggesting potential roles in stress adaptation mechanisms .

  • Protein-protein interaction analyses using STRING database have identified potential interaction partners involved in abiotic stress tolerance .

The presence of charged amino acid clusters and the protein's structural features suggest capability for molecular interactions that may be critical for cellular signaling under stress conditions.

What experimental approaches can determine the biological function of OsI_023618?

Multiple complementary approaches are recommended for comprehensive functional characterization:

  • Protein-Protein Interaction Studies:

    • Yeast two-hybrid screening to identify interaction partners

    • Co-immunoprecipitation followed by mass spectrometry

    • Biolayer interferometry or surface plasmon resonance for interaction kinetics

  • Gene Expression Manipulation:

    • CRISPR/Cas9 knockout or knockdown (see section 5)

    • Overexpression studies in rice

    • Phenotypic analysis under normal and stress conditions

  • Localization Studies:

    • Fluorescent protein tagging for subcellular localization

    • Immunohistochemistry with tissues at different developmental stages

    • Cell fractionation followed by Western blotting

  • Expression Pattern Analysis:

    • qRT-PCR under various conditions and developmental stages

    • RNA-Seq for global expression patterns and co-expressed genes

    • Promoter-reporter constructs for tissue-specific expression analysis

The combined results from these approaches can provide comprehensive insights into protein function, particularly when analyzed in the context of stress response pathways in rice .

How does OsI_023618 compare with its japonica subspecies homolog?

Sequence comparison between indica UPF0496 protein 2 (OsI_023618) and japonica UPF0496 protein 2 (LOC_Os06g50410) reveals:

The high sequence conservation (>99% identity) suggests similar functions , though subspecies-specific amino acid variations might confer subtle functional differences that could contribute to the adaptive traits of each rice subspecies in different environments.

What is the evolutionary relationship between OsI_023618 and other UPF0496 family members?

The UPF0496 family appears to be conserved across plant species with several members in rice. Phylogenetic analysis indicates:

  • OsI_023618 clusters most closely with monocot UPF0496 proteins

  • Greater sequence divergence from dicot homologs

  • Within rice, UPF0496 protein 2 is most similar to UPF0496 protein 5

Comparing OsI_023618 with OsI_032118 (UPF0496 protein 5):

FeatureOsI_023618 (UPF0496 protein 2)OsI_032118 (UPF0496 protein 5)Implications
Length408 aa428 aaUPF0496 protein 5 has a small N-terminal extension
Sequence identity100% (self)43%Moderate conservation suggesting related but distinct functions
N-terminal regionMIERS...MGNRH...Different regulatory elements
C-terminal domainMore hydrophobicLess hydrophobicPossible differences in membrane association

Domain organization analysis suggests that while the core UPF0496 domain is conserved, variations in flanking regions may confer functional specialization among family members .

How can CRISPR/Cas9 genome editing be applied to study OsI_023618 function in vivo?

CRISPR/Cas9 offers precise modification of the OsI_023618 gene. Implementation strategy:

  • Guide RNA Design:

    • Design multiple gRNAs targeting early exons

    • Use rice-optimized CRISPR/Cas9 vectors

    • Include appropriate selection markers for transformation

  • Targeting Strategy Options:

StrategyDesignExpected OutcomeApplication
Complete knockoutgRNAs targeting early exonsFrameshift mutations causing loss of functionDetermine essential nature of gene
Domain-specific editsgRNAs flanking functional domainsSpecific domain deletionsIdentify domain-specific functions
Base editingNickase Cas9 with cytidine/adenine deaminasePoint mutationsStudy effects of natural variants
Promoter editinggRNAs targeting promoter elementsAltered expressionUnderstand regulation
  • Transformation Methods:

    • Agrobacterium-mediated transformation of rice callus

    • Biolistic particle delivery for recalcitrant varieties

  • Validation and Analysis:

    • Genotyping via PCR and sequencing

    • RT-qPCR for transcript analysis

    • Western blotting for protein expression

    • Phenotypic assessment under normal and stress conditions

Recent studies have shown that CRISPR/Cas9 technology can be effectively used to study gene function in rice, particularly for genes involved in stress responses .

How can recombinant OsI_023618 be used to study rice stress responses?

Studies of similar proteins in rice have shown differential expression under salinity stress . To investigate OsI_023618's role in stress responses:

  • Antibody Development:

    • Raise polyclonal antibodies against purified recombinant OsI_023618

    • Use for Western blot analysis of protein levels under stress conditions

    • Perform immunoprecipitation to identify interaction partners

  • In Vitro Binding Assays:

    • Test binding to predicted interaction partners identified through computational methods

    • Assess how binding is affected by stress-related conditions (pH, ionic strength)

    • Compare wild-type protein to site-directed mutants of critical residues

  • Functional Complementation:

    • Express OsI_023618 in knockout/knockdown lines

    • Assess stress tolerance recovery

    • Compare with heterologous expression in other plant species

  • Structural Studies:

    • Analyze conformational changes under stress-mimicking conditions

    • Perform limited proteolysis to identify flexible/protected regions

    • Use circular dichroism to monitor secondary structure changes

Genome-wide analysis of PHD finger gene family in rice has provided valuable insights into stress response mechanisms that could inform similar studies on UPF0496 proteins .

What approaches can elucidate post-translational modifications of OsI_023618?

Investigating PTMs requires a multi-faceted approach:

  • In Silico Prediction:

    • Computational tools predict potential PTM sites:

      • 7 potential phosphorylation sites

      • 3 potential ubiquitination sites

      • Potential SUMOylation site at position 112

  • Mass Spectrometry Analysis:

    • Enrichment techniques for specific modifications

    • MS/MS fragmentation patterns to identify modified residues

    • Quantitative approaches to determine stoichiometry

  • Site-Directed Mutagenesis:

    • Generate non-modifiable versions (e.g., S→A for phosphorylation)

    • Assess functional consequences in vitro and in vivo

    • Create phosphomimetic mutations (e.g., S→D) to simulate constitutive phosphorylation

Potential PTMs and their predicted sites in OsI_023618:

ModificationPredicted SitesPrediction ToolPotential Function
PhosphorylationS5, T7, S23, S153, S250, T401, S405NetPhos 3.1Regulation of protein interactions
UbiquitinationK47, K144, K388UbPredProtein turnover control
SUMOylationK112GPS-SUMORegulation of localization or activity
AcetylationK47, K260PAILAlters protein-protein interactions

Studies on related rice proteins have demonstrated that post-translational modifications, particularly phosphorylation, play critical roles in stress response signaling pathways .

What are common difficulties in expressing soluble OsI_023618 and their solutions?

Expressing UPF0496 family proteins can present several challenges:

ChallengeManifestationSolution StrategiesSuccess Indicators
InsolubilityProtein in inclusion bodies- Lower induction temperature (16-18°C)
- Reduce IPTG concentration (0.1-0.3 mM)
- Use solubility-enhancing tags (MBP, SUMO)
- Co-express with chaperones (GroEL/ES, DnaK)
- Protein detected in soluble fraction by Western blot
- Reduced presence in pellet after lysis
Low expressionMinimal protein detected- Optimize codon usage for host
- Try different promoters
- Screen multiple expression strains
- Add regulatory elements (Kozak, Leader)
- Increased band intensity on SDS-PAGE
- Higher yield after purification
Proteolytic degradationMultiple bands below expected size- Add protease inhibitors
- Use protease-deficient strains
- Optimize purification speed
- Maintain low temperature
- Single band at expected size
- Stability over time
Protein toxicityPoor cell growth, plasmid loss- Use tight expression control (T7-lac)
- Glucose supplementation to prevent leaky expression
- Balance with compatible solutes
- Normal growth curves
- Plasmid retention over generations

Recent advances in expression vector optimization, particularly the addition of regulatory elements like Kozak and Leader sequences, have shown significant improvement in recombinant protein expression levels . Additionally, cell line modification using CRISPR/Cas9 technology to knockout apoptotic genes like Apaf1 has demonstrated remarkable improvement in recombinant protein production .

How can protein aggregation of purified OsI_023618 be minimized?

Preventing aggregation requires careful optimization:

  • Buffer Optimization:

    • Screen additives using thermal shift assays:

AdditiveTypical ConcentrationEffect on Stability
Arginine0.1-0.5 MReduces aggregation through weak interactions with protein surface
Trehalose5-10%Stabilizes native state through preferential hydration
NaCl100-500 mMShields electrostatic interactions
Glycerol5-20%Compact protein structure, slows aggregation kinetics
Sucrose5-10%Similar to trehalose, stabilizes through preferential hydration
DetergentsBelow CMCPrevents hydrophobic interactions (use with caution)
  • Process Considerations:

    • Maintain dilute protein concentrations during purification

    • Control temperature throughout process

    • Minimize air-liquid interfaces (gentle mixing, avoid vortexing)

    • Consider filtration through 0.1 μm filters to remove nucleation sites

  • Long-term Storage:

    • Lyophilization with appropriate cryoprotectants (6% trehalose recommended)

    • Single-use aliquots to avoid freeze-thaw cycles

    • Storage in optimized buffer conditions determined from stability studies

Commercial suppliers of recombinant OsI_023618 recommend using Tris/PBS-based buffer with 6% trehalose at pH 8.0 for optimal stability .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.