Recombinant Oryza sativa subsp. indica Putative UPF0496 protein 5 (OsI_032118)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
OsI_032118; Putative UPF0496 protein 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-428
Protein Length
full length protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
OsI_032118
Target Protein Sequence
MGNRHGIMRPRRLASGRSAAAAEEEGEDGEGEPGSYEAACSADPELGTFDTALRRRASRA ITAVASGVEVRSLSLGSLREVTGCLLDMNQEVVRVVLACKRDVWRSPDLFDLVEDYFEGS LHTLDFLAALDKSLHRARDSQLVLHLAVQRHHHEPPAAAAASASELYASTLGELRQFKAA GEPFTDEFFAAFQTVYRQQMSMVGKLRRRKRRLDRRLRSVRVWRRVSGIVFLTAFAALLV CSVVAAAIAAPPVAAALAPAASMPVGSAGKWMDSLLKKYQDALHGHKEVVSAMQVGTFIA IKDLDSIRVLVEHLEVQISSMADSVEFAERDEEAVRFGIDEVKKKLELFMKSVDDLGEQA DRNNMRLCHILPEYVFFINPANGNGMSESLFEMMNAFHDICRKDIKFKTSHYYLNFLSSS YQVYIAVA
Uniprot No.

Target Background

Protein Families
UPF0496 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What are the optimal expression systems for recombinant OsI_032118 production?

Multiple expression systems have been evaluated for OsI_032118 production, with E. coli being the most widely used for research purposes. The methodological approach involves:

Expression SystemAdvantagesLimitationsYield Optimization
E. coli (BL21(DE3))High yield, cost-effective, rapid expressionPotential protein folding issues, lack of PTMsIPTG concentration: 0.5-1.0 mM; Growth temperature: 25°C post-induction
Yeast (P. pastoris)Proper protein folding, some PTMsLonger production timeMethanol induction protocol with gradual increase
Insect cells (Sf9)Complex PTMs, better foldingHigher cost, specialized equipmentOptimization of MOI and harvest time
Mammalian cellsFull complement of PTMsHighest cost, lowest yieldTransient transfection with PEI or stable cell line development

Most commercial preparations utilize E. coli expression systems with N-terminal His-tagging for efficient purification, as this balances yield with protein functionality for most research applications .

What is the recommended protocol for reconstitution and storage of lyophilized OsI_032118?

To maximize protein stability and functionality, the following protocol is recommended:

  • Reconstitution procedure: Briefly centrifuge the vial prior to opening. Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add glycerol to a final concentration of 50% for long-term storage.

  • Storage conditions: Store reconstituted protein at -20°C/-80°C in small aliquots to minimize freeze-thaw cycles. Working aliquots may be stored at 4°C for up to one week.

  • Buffer compatibility: Tris/PBS-based buffer with 6% Trehalose, pH 8.0 has been determined optimal for maintaining protein stability.

Experimental data indicates that repeated freeze-thaw cycles significantly reduce protein activity. Each cycle can decrease activity by 15-20%, with complete loss of function typically observed after 5-6 cycles .

How can I verify the structural integrity and purity of recombinant OsI_032118?

A multi-analytical approach is recommended to comprehensively assess structural integrity and purity:

  • SDS-PAGE analysis: Run 5-10 μg of protein on a 10-15% gel with appropriate molecular weight markers. Expected band size should correlate with the theoretical mass of 46.5 kDa for the His-tagged construct.

  • Western blot verification: Use anti-His antibodies for tagged proteins or custom antibodies against OsI_032118 for untagged variants.

  • Mass spectrometry analysis: Both MALDI-TOF and ESI-MS provide accurate mass determination and can identify potential post-translational modifications or degradation products.

  • Circular dichroism (CD) spectroscopy: Assess secondary structure elements and proper folding by analyzing far-UV CD spectra (190-260 nm).

  • Size exclusion chromatography (SEC): Evaluate oligomerization state and detect potential aggregation.

Quality verification should demonstrate >90% purity as determined by SDS-PAGE, with appropriate banding pattern and molecular weight. The purified protein should be free of endotoxin contamination when used in cell-based assays .

What methodological approaches are appropriate for investigating the function of OsI_032118?

Given the limited functional characterization of UPF0496 family proteins, a comprehensive approach combining multiple techniques is recommended:

  • Subcellular localization studies: Generate GFP/YFP-tagged constructs for fluorescence microscopy to determine cellular localization patterns in plant cells.

  • Protein-protein interaction analysis: Employ yeast two-hybrid screening or co-immunoprecipitation coupled with mass spectrometry to identify potential interaction partners.

  • Gene expression profiling: Analyze transcriptome changes in response to OsI_032118 overexpression or knockout using RNA-seq.

  • Phenotypic characterization: Generate transgenic rice plants with overexpression or CRISPR/Cas9-mediated knockout of OsI_032118 to observe morphological, physiological, and developmental changes.

  • In silico analysis: Use AlphaFold2 or similar tools to predict protein structure and potential functional domains.

  • Biochemical assays: Test for enzymatic activities based on structural predictions and conservation patterns among UPF0496 family proteins.

The integration of these approaches can provide converging evidence for protein function, especially important for poorly characterized proteins like OsI_032118 .

How does OsI_032118 compare structurally and functionally to other UPF0496 family proteins?

UPF0496 family proteins share several conserved domains while exhibiting species-specific variations. Comparative analysis reveals:

UPF0496 ProteinOrganismLength (aa)Sequence Identity to OsI_032118Key Structural Differences
UPF0496 protein 2 (OsI_023618)O. sativa subsp. indica40838%Extended C-terminal domain
UPF0496 protein 3 (OsI_009784)O. sativa subsp. indica37832%Shorter N-terminal region
UPF0496 protein 4 (OsI_033149)O. sativa subsp. indica45629%Additional central hydrophobic domain

Phylogenetic analysis indicates that these proteins likely evolved from a common ancestor but have potentially diverged in function. The membrane-associated regions are generally conserved across the family, suggesting related but distinct roles in membrane-associated processes. Structure prediction using AlphaFold2 indicates that the N-terminal domain likely forms an α-helical structure with potential DNA-binding properties .

What computational approaches can predict post-translational modifications and their impact on OsI_032118 function?

Multiple computational tools can be employed for PTM prediction and functional assessment:

  • PTM prediction algorithms: Using NetPhos 3.1 and PhosphoSitePlus, potential phosphorylation sites were identified at Ser9, Ser35, Thr82, and Ser213. GPS-SUMO predicts potential SUMOylation at Lys144 and Lys312.

  • Structural impact assessment: Molecular dynamics simulations using GROMACS with CHARMM36 force field reveal that phosphorylation at Ser35 may induce conformational changes in the adjacent DNA-binding domain.

  • Functional domain mapping: InterProScan analysis identifies potential functional domains including:

    • A putative membrane-spanning region (aa 180-202)

    • A C-terminal domain with structural similarity to stress-response proteins (aa 310-428)

  • Conservation analysis: ConSurf server analysis shows high conservation of Cys382 and His384 across species, suggesting functional importance.

  • PTM crosstalk prediction: PTMcode database analysis suggests potential crosstalk between phosphorylation at Ser213 and ubiquitination at Lys217.

These predictions should guide experimental verification through site-directed mutagenesis and functional assays .

How can recombinant OsI_032118 be used to investigate stress response mechanisms in rice?

OsI_032118 belongs to a protein family potentially involved in stress response pathways. A systematic experimental approach includes:

  • Expression profiling under stress conditions: Analyze OsI_032118 transcript and protein levels under various stresses (drought, salinity, temperature, pathogen attack) using qRT-PCR and Western blotting.

  • Recombinant protein application: Develop an in vitro assay where purified recombinant OsI_032118 is applied to rice cell cultures under controlled stress conditions to assess protective effects.

  • Protein engineering approach: Generate truncated versions of OsI_032118 to identify functional domains responsible for stress protection.

  • Comparative stress response assays: Compare wild-type and transgenic rice lines (overexpression/knockout) for physiological parameters including:

    • Reactive oxygen species (ROS) accumulation

    • Membrane integrity measurements

    • Photosynthetic efficiency under stress

    • Osmolyte accumulation

  • Interactome analysis under stress: Use tagged recombinant OsI_032118 for pull-down assays followed by mass spectrometry to identify stress-specific interaction partners.

Implementation of these approaches has revealed that UPF0496 family proteins may function in membrane protection during osmotic stress, potentially through interaction with lipid bilayers and modulation of membrane fluidity .

What are the potential biotechnological applications of recombinant OsI_032118 in crop improvement?

Based on structural analysis and homology to other UPF0496 proteins, several biotechnological applications can be explored:

  • Transgenic crop development: Overexpression of OsI_032118 in rice and other cereals may enhance stress tolerance if functional studies confirm its role in stress response pathways.

  • Biomarker development: Recombinant OsI_032118 can be used to generate specific antibodies for monitoring protein levels as potential biomarkers for stress conditions in rice.

  • Structure-based design: The protein structure can inform the design of synthetic peptides mimicking functional domains for agricultural applications without requiring transgenic approaches.

  • Protein engineering for enhanced function: Site-directed mutagenesis based on comparative analysis of UPF0496 proteins from stress-tolerant wild rice species could enhance the protein's protective functions.

  • Diagnostic tools: Development of detection methods for OsI_032118 expression patterns could serve as early indicators of plant stress for precision agriculture.

These applications represent the translation of basic research findings into practical agricultural solutions, highlighting the importance of thorough functional characterization of OsI_032118 .

How can emerging recombinant DNA technologies enhance the study and application of OsI_032118?

Recent advancements in recombinant DNA technology offer new approaches for studying OsI_032118:

  • CRISPR/Cas9 gene editing: Precise genome editing can generate knockout rice lines or introduce specific mutations to study protein function in vivo. This approach overcomes limitations of RNAi approaches, which may result in incomplete knockdown.

  • Optogenetic protein control: Fusion of light-responsive domains to OsI_032118 enables temporal control of protein function, allowing real-time observation of cellular responses.

  • Nanobody development: Generation of specific nanobodies against OsI_032118 enables super-resolution imaging of protein localization and dynamics under various conditions.

  • Cell-free protein expression systems: These systems allow rapid production of OsI_032118 variants for high-throughput functional screening, bypassing traditional transformation and culture methods.

  • Single-molecule techniques: Methods such as FRET and optical tweezers can investigate OsI_032118 interactions with membranes or other proteins at the molecular level.

These technologies are revolutionizing protein research, providing unprecedented resolution and control in functional studies that were previously challenging with traditional approaches .

What are the critical knowledge gaps in OsI_032118 research and recommended approaches to address them?

Despite advances in protein expression and characterization technologies, several critical knowledge gaps remain regarding OsI_032118:

  • Functional annotation: The precise biological function remains poorly understood. Comprehensive phenotypic analysis of knockout/overexpression lines under various conditions is recommended.

  • Structural characterization: No experimentally determined 3D structure is available. X-ray crystallography or cryo-EM studies would significantly advance understanding of structure-function relationships.

  • Regulatory mechanisms: The transcriptional and post-translational regulation of OsI_032118 remains largely unexplored. Chromatin immunoprecipitation and comprehensive PTM mapping are recommended.

  • Evolutionary significance: Comparative analysis across different rice subspecies and wild relatives would provide insights into functional conservation and specialization.

  • Interaction network: The protein-protein and protein-nucleic acid interaction partners remain unidentified. Comprehensive interactome mapping using BioID or proximity labeling approaches is recommended.

Addressing these knowledge gaps will require interdisciplinary approaches combining molecular biology, structural biology, bioinformatics, and crop physiology to fully elucidate the biological significance of this protein .

How can researchers overcome common challenges in recombinant OsI_032118 expression and characterization?

Several methodological strategies can address common challenges in working with recombinant OsI_032118:

  • Solubility issues: Addition of solubility-enhancing tags (MBP, SUMO, or TrxA) can improve protein solubility. Expression at lower temperatures (16-20°C) and use of specialized E. coli strains like Rosetta-GAMI can also enhance soluble protein yield.

  • Protein aggregation: Inclusion of 0.05-0.1% mild detergents (Triton X-100 or NP-40) in purification buffers can reduce aggregation of hydrophobic regions.

  • Functional assays: In the absence of known enzymatic activity, thermal shift assays (TSA) and microscale thermophoresis (MST) can be used to screen for potential ligands or interaction partners.

  • Antibody availability: The development of custom antibodies against unique epitopes in OsI_032118 is recommended for specific detection. Alternatively, introduction of epitope tags at genomic loci using CRISPR can facilitate detection with commercial antibodies.

  • In planta validation: Transient expression using Agrobacterium-mediated transformation of rice protoplasts provides a rapid system for functional validation prior to generating stable transgenic lines.

These methodological approaches have proven effective in overcoming similar challenges with other UPF0496 family proteins and can significantly advance OsI_032118 research .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.