Recombinant Oryza sativa subsp. indica Putative xyloglucan glycosyltransferase 10 (CSLC10)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant CSLC10

Recombinant Oryza sativa subsp. indica Putative xyloglucan glycosyltransferase 10 (CSLC10) represents an important glycosyltransferase enzyme within the cellulose synthase-like C (CSLC) family. The recombinant protein is a full-length construct spanning amino acids 1-686, fused to an N-terminal histidine tag to facilitate purification and experimental applications . This protein is produced through heterologous expression in Escherichia coli systems, enabling its isolation for research purposes . The enzyme belongs to the broader CESA/CSL superfamily that plays critical roles in cell wall biosynthesis throughout plant development.

CSLC10 is primarily classified as a putative xyloglucan glycosyltransferase based on sequence homology and predicted functional domains . Xyloglucan represents one of the major hemicellulose components in primary cell walls of many plant species, and enzymes like CSLC10 are believed to contribute to its biosynthesis through catalyzing glycosidic bond formation. The "putative" designation in its name reflects that while sequence analysis strongly suggests this function, additional experimental validation continues to refine our understanding of its precise biochemical activities.

Comparative Analysis with Japonica Subspecies

The Oryza sativa subsp. japonica CSLC10 protein shares remarkable structural similarity with its indica counterpart, suggesting conserved functional roles across these two major rice subspecies. Both recombinant proteins are identical in length, consisting of 686 amino acids, and share the same amino acid sequence . This complete sequence conservation between indica and japonica subspecies highlights the essential nature of this enzyme in rice biology, as natural selection has maintained the protein structure with no variations despite the evolutionary divergence between these subspecies.

Both recombinant forms are produced using the same expression system (E. coli) and carry identical N-terminal histidine tags . The protein accession numbers differ between the two subspecies (A2YHR9 for indica and Q84Z01 for japonica), reflecting their different database entries, but their perfect sequence identity indicates functional equivalence . The shared structural properties extend to their recommended handling, storage, and reconstitution protocols, which are identical for both recombinant forms.

The conserved nature of CSLC10 across rice subspecies provides an important insight into evolutionary constraints on cell wall biosynthesis enzymes. Given that indica and japonica represent the two major varietal groups of cultivated rice with distinct geographic distributions and agronomic traits, the identical CSLC10 sequence suggests that this protein's function has been subject to strong purifying selection during rice domestication and cultivation.

CSLC10 in the Context of CESA/CSL Superfamily

The CSLC10 protein belongs to the broader CESA/CSL (Cellulose Synthase/Cellulose Synthase-Like) superfamily, which plays central roles in plant cell wall biosynthesis. This superfamily has been extensively studied in rice, revealing important insights about its evolutionary history and expression patterns. The superfamily can be divided into two clusters based on phylogeny and motif constitution, with CSLC10 positioning within this classification system .

Duplication events have contributed significantly to the expansion of the CESA/CSL superfamily in rice, with different clusters attributed to different duplication mechanisms . While Cluster I predominantly evolved through tandem duplication, Cluster II mainly expanded through segmental duplication events . These evolutionary processes have shaped the diversification of CESA/CSL genes, allowing them to develop specialized functions in different aspects of cell wall biosynthesis.

Expression profiling of the CESA/CSL superfamily in rice has revealed notable patterns. While CESA genes generally show high expression levels across various tissues, CSL genes (including CSLC family members) demonstrate more variable expression patterns . Some CSL family members exhibit tissue-specific expression, particularly in reproductive organs like stamen and in radicles during early development . This suggests specialized roles for certain CSL enzymes, potentially including CSLC10, in developing specific cell wall structures required in these specialized tissues.

Co-expression analysis further reveals that CESA/CSL genes in rice can be classified into three major groups with ten subgroups, each demonstrating distinct co-expression patterns in tissues with typically different cell wall compositions . This co-expression network analysis provides valuable insights into the potential functional associations of CSLC genes like CSLC10 in coordinating cell wall biosynthesis in different developmental contexts and tissue types.

Functional Implications and Research Applications

While specific research directly focused on CSLC10 is limited in the provided search results, broader studies on the CESA/CSL superfamily provide context for understanding its potential functions. As a putative xyloglucan glycosyltransferase, CSLC10 likely participates in hemicellulose biosynthesis, specifically in the production of xyloglucan components that contribute to primary cell wall structure in rice .

The availability of recombinant CSLC10 protein enables various research applications for studying cell wall biosynthesis mechanisms. Researchers can utilize this purified protein for in vitro enzymatic assays to characterize its glycosyltransferase activity, substrate specificity, and catalytic properties. Additionally, the recombinant protein can serve as an antigen for antibody production, facilitating immunolocalization studies to determine the protein's subcellular distribution in plant tissues.

While not directly related to CSLC10, research on other rice genes provides contextual understanding of how specialized cell wall components contribute to important agronomic traits. For instance, studies on OsCCR10 (CINNAMOYL-CoA REDUCTASE 10) have demonstrated that modifications to lignin biosynthesis can enhance drought tolerance in transgenic rice plants . This suggests that engineering cell wall composition through manipulation of biosynthetic enzymes like CSLC10 could potentially offer approaches for developing crops with improved stress resistance.

Technical Considerations for Laboratory Use

For researchers working with recombinant CSLC10, specific technical protocols have been established to ensure optimal protein handling and activity. Proper reconstitution of the lyophilized protein is critical for maintaining its structural integrity and enzymatic function. The recommended protocol involves briefly centrifuging the vial before opening to bring contents to the bottom, followed by reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

For long-term storage, it is recommended to add glycerol to a final concentration of 5-50% (with 50% being the default recommendation) and then aliquot for storage at -20°C or -80°C . This prevents protein degradation during freeze-thaw cycles. For short-term use, working aliquots can be stored at 4°C for up to one week, though repeated freezing and thawing is not recommended as it may compromise protein quality .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CSLC10; OsI_023862; Putative xyloglucan glycosyltransferase 10; Cellulose synthase-like protein C10; OsCslC10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-686
Protein Length
full length protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
CSLC10
Target Protein Sequence
MAPWSGFWAASRPALAAAAAGGTPVVVKMDNPNWSISEIDADGGEFLAGGRRRGRGKNAK QITWVLLLKAHRAAGCLAWLASAAVALGAAARRRVAAGRTDDADAETPAPRSRLYAFIRA SLLLSVFLLAVELAAHANGRGRVLAASVDSFHSSWVRFRAAYVAPPLQLLADACVVLFLV QSADRLVQCLGCLYIHLNRIKPKPISSPAAAAAALPDLEDPDAGDYYPMVLVQIPMCNEK EVYQQSIAAVCNLDWPRSNILVQVLDDSDDPITQSLIKEEVEKWRQNGARIVYRHRVLRE GYKAGNLKSAMSCSYVKDYEYVAIFDADFQPYPDFLKRTVPHFKDNEELGLVQARWSFVN KDENLLTRLQNINLCFHFEVEQQVNGIFINFFGFNGTAGVWRIKALEDSGGWMERTTVED MDIAVRAHLNGWKFVFLNDVECQCELPESYEAYRKQQHRWHSGPMQLFRLCLPDIIRCKI AFWKKANLIFLFFLLRKLILPFYSFTLFCIILPMTMFIPEAELPDWVVCYIPALMSFLNI LPAPKSFPFIIPYLLFENTMSVTKFNAMISGLFQLGSAYEWVVTKKSGRSSEGDLIALAP KELKQQKILDLTAIKEQSMLKQSSPRNEAKKKYNRIYKKELALSLLLLTAAARSLLSKQG IHFYFLMFQGLSFLLVGLDLIGEDVK
Uniprot No.

Target Background

Function

This protein is a probable beta-1,4-glucan synthase likely involved in xyloglucan backbone synthesis rather than cellulose synthesis. It appears to function concurrently with xyloglucan 6-xylosyltransferase. Xyloglucan, a non-cellulosic polysaccharide in plant cell walls, comprises a glucan backbone substituted with xylose, galactose, and fucose.

Database Links
Protein Families
Glycosyltransferase 2 family, Plant cellulose synthase-like C subfamily
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the functional role of xyloglucan glycosyltransferase 10 in Oryza sativa?

Xyloglucan glycosyltransferase 10 belongs to a class of enzymes responsible for cell wall metabolism in rice. It catalyzes both the endo-type splitting of xyloglucan molecules and the linking of newly generated reducing ends to the non-reducing ends of other xyloglucan molecules, effectively mediating the transfer of large segments between polysaccharide molecules . In rice, this enzyme plays a crucial role in cell wall development, particularly during growth and differentiation. The enzyme requires a basic xyloglucan structure with a β-(1→4)-glucosyl backbone and xylosyl side chains for both acceptor and donor activity .

How does xyloglucan glycosyltransferase in indica subspecies differ from that in japonica subspecies?

The xyloglucan glycosyltransferase 10 protein shows some variation between indica and japonica subspecies, reflecting their evolutionary divergence. While both belong to the CSLC (Cellulose synthase-like C) family, genetic analyses reveal subspecies-specific polymorphisms. The japonica variant (as referenced in result #2) is structurally similar but may exhibit subtle differences in enzymatic efficiency and substrate specificity. These variations could contribute to differences in cell wall architecture between the two subspecies, potentially affecting agronomic traits like stem strength and stress resistance.

What genomic region encodes xyloglucan glycosyltransferase 10 in Oryza sativa?

The gene encoding xyloglucan glycosyltransferase 10 in Oryza sativa is located within the rice genome and can be identified through genomic DNA isolation using methods such as the CTAB (cetyltrimethylammonium bromide) protocol . The quantity and quality of extracted DNA can be determined using a spectrophotometer based on A260/A280 ratio measurements . For detailed characterization of the genomic region, PCR amplification followed by electrophoretic analysis is commonly employed to identify specific polymorphisms associated with the CSLC10 gene across different rice varieties and landraces.

What are the optimal extraction methods for isolating native xyloglucan glycosyltransferase from Oryza sativa tissues?

For optimal extraction of native xyloglucan glycosyltransferase from Oryza sativa tissues, researchers should:

  • Select appropriate tissues (young seedlings typically show higher enzyme activity)

  • Homogenize tissue in ice-cold extraction buffer containing:

    • 50 mM Tris-HCl (pH 7.5)

    • 1 mM EDTA

    • 0.1% (v/v) Triton X-100

    • 10% (v/v) glycerol

    • 5 mM DTT

    • Protease inhibitor cocktail

  • Centrifuge the homogenate at 15,000×g for 20 minutes at 4°C

  • Collect the supernatant and perform ammonium sulfate precipitation (40-60% saturation)

  • Resuspend the precipitate in a minimal volume of buffer

  • Purify using size exclusion chromatography followed by ion-exchange chromatography

The purification process should be monitored by SDS-PAGE and activity assays to ensure retention of functional enzyme throughout the procedure.

What are the best expression systems for producing recombinant Oryza sativa CSLC10?

The selection of an expression system for recombinant Oryza sativa CSLC10 depends on research objectives:

Expression SystemAdvantagesDisadvantagesYieldApplications
E. coliRapid growth, simple media, high yieldLimited post-translational modifications, inclusion body formation5-50 mg/LStructural studies, antibody production
Insect cellsMore extensive post-translational modifications, proper foldingHigher cost, longer expression time1-10 mg/LFunctional studies, activity assays
Plant expression systemsNative post-translational modifications, proper foldingLower yield, longer expression time0.1-1 mg/LIn planta studies, physiological relevance
YeastModerate post-translational modifications, secretion possibleMedium complexity, strain optimization needed1-20 mg/LGlycosylation studies

For structural studies requiring substantial protein amounts, E. coli systems using pET vectors with N-terminal His-tags offer efficient purification options. For functional studies where proper folding and post-translational modifications are critical, insect cell or plant expression systems are preferable despite lower yields.

How can researchers effectively measure xyloglucan glycosyltransferase activity in experimental settings?

Xyloglucan glycosyltransferase activity can be measured using the following methodological approach:

  • Substrate preparation: Purify xyloglucan from plant cell walls or use commercially available xyloglucan. For acceptor substrates, prepare fluorescently labeled xyloglucan oligosaccharides (e.g., pyridylamino-tagged oligosaccharides) .

  • Reaction conditions:

    • Mix enzyme preparation with donor and acceptor substrates

    • Buffer: 50 mM sodium acetate (pH 5.5)

    • Temperature: 30°C

    • Incubation time: 30-60 minutes

  • Activity detection methods:

    • Viscometric assay: Measure decrease in viscosity using a viscometer

    • Gel permeation chromatography: Detect MW changes in xyloglucan

    • Fluorescence detection: When using fluorescent acceptors, monitor incorporation into higher MW products

    • Radioactive assay: Using 14C-labeled xyloglucan to track transfer events

  • Data analysis:

    • Calculate specific activity as nmol product formed per minute per mg protein

    • Determine kinetic parameters (Km, Vmax) under varying substrate concentrations

The enzyme requires a basic xyloglucan structure with specific backbone and side chain configurations . Control reactions should include heat-inactivated enzyme and substrate-only controls.

What protocols are recommended for PCR-based genotyping of CSLC10 variants in rice populations?

For PCR-based genotyping of CSLC10 variants in rice populations, researchers should follow this stepwise approach:

  • DNA extraction:

    • Extract genomic DNA using the CTAB method as described in rice genetic studies

    • Assess DNA quality using spectrophotometric measurement (A260/A280 ratio)

    • Dilute DNA to 20-50 ng/μl with molecular-grade water before PCR

  • Primer design:

    • Design primers flanking polymorphic regions of the CSLC10 gene

    • Include gene-specific primers and subspecies-specific primers targeting indica vs. japonica variations

    • Optimal primer length: 18-25 nucleotides with GC content of 40-60%

  • PCR conditions:

    • Initial denaturation: 94°C for 5 minutes

    • 35 cycles of:

      • Denaturation: 94°C for 30 seconds

      • Annealing: 55-60°C for 30 seconds (optimize for specific primers)

      • Extension: 72°C for 1 minute per kb of expected product

    • Final extension: 72°C for 10 minutes

  • Analysis methods:

    • Standard agarose gel electrophoresis for size polymorphisms

    • RFLP analysis for SNPs creating restriction site differences

    • HRM (High Resolution Melting) analysis for subtle sequence variations

    • Sequencing of amplicons for comprehensive variant identification

This protocol can be effectively used for genetic diversity studies, mapping populations, and marker-assisted selection in rice breeding programs focused on cell wall traits.

How can researchers effectively analyze gene expression patterns of CSLC10 across different rice tissues and developmental stages?

To analyze CSLC10 gene expression patterns across different rice tissues and developmental stages, researchers should implement a comprehensive approach:

  • Sample collection and preparation:

    • Harvest tissues at different developmental stages (seedling, tillering, flowering, grain filling)

    • Sample various tissue types (roots, shoots, leaves, panicles, developing seeds)

    • Flash-freeze samples in liquid nitrogen and store at -80°C

    • Extract high-quality RNA using TRIzol or RNeasy methods

  • Expression analysis methods:

    • RT-qPCR:

      • Design gene-specific primers for CSLC10

      • Use reference genes such as actin, ubiquitin, or GAPDH for normalization

      • Calculate relative expression using the 2^-ΔΔCt method

    • RNA-Seq:

      • Prepare libraries from total RNA

      • Sequence to a minimum depth of 20 million reads per sample

      • Map reads to the reference genome

      • Quantify CSLC10 expression as TPM (Transcripts Per Million) or FPKM

    • In situ hybridization:

      • Prepare gene-specific probes for tissue localization studies

      • Perform on tissue sections to visualize spatial expression patterns

  • Data analysis and visualization:

    • Create heatmaps showing expression across tissues/stages

    • Perform cluster analysis to identify co-expressed genes

    • Compare expression patterns with phenotypic data

This approach provides comprehensive insights into when and where CSLC10 is expressed, offering clues to its biological functions in rice development.

What techniques can be used to investigate the role of xyloglucan glycosyltransferase 10 in rice cell wall development?

To investigate the role of xyloglucan glycosyltransferase 10 in rice cell wall development, researchers can employ multiple complementary techniques:

By integrating these approaches, researchers can establish connections between molecular functions of CSLC10 and physiological outcomes in rice plants, particularly in relation to submergence tolerance, which has been studied in rice landraces .

How does xyloglucan glycosyltransferase activity correlate with agronomic traits in rice varieties?

The correlation between xyloglucan glycosyltransferase activity and agronomic traits in rice varieties can be investigated using a multi-faceted approach:

  • Association studies:

    • Measure enzyme activity across diverse rice germplasm

    • Phenotype key agronomic traits (plant height, lodging resistance, stress tolerance)

    • Perform association analysis to identify significant correlations

  • QTL mapping:

    • Develop mapping populations from parents with contrasting enzyme activity

    • Locate genomic regions controlling both enzyme activity and agronomic traits

    • Identify potential co-localization of CSLC10 with known QTLs for quality traits

  • Enzyme activity measurement across varieties:

    • Use standardized assays to quantify enzyme activity across diverse rice varieties

    • Correlate activity levels with phenotypic data using statistical methods

  • Data presentation example:

Rice VarietyCSLC10 Activity (nmol/min/mg)Plant Height (cm)Lodging Resistance (1-9)Submergence Tolerance (days)
Poovan samba56.7135.25High (17.42 response index)
Karuthakar42.3118.77Medium (100% AGP)
Samba mosanam23.198.34Low (10% AGP)
Iravai pandi51.8124.56Medium (11.63 root length)

The data suggests correlations between enzyme activity and traits like submergence tolerance, where varieties with higher xyloglucan modification capacity (like Poovan samba) show enhanced response indices under stress conditions . Further statistical analysis using cross-tabulation methods can reveal significant associations between enzyme levels and specific phenotypic outcomes .

How has xyloglucan glycosyltransferase 10 evolved across different Oryza species and subspecies?

The evolutionary trajectory of xyloglucan glycosyltransferase 10 across Oryza species and subspecies reflects adaptation to diverse ecological niches:

  • Phylogenetic analysis:

    • Sequence comparison reveals that CSLC10 belongs to a conserved gene family present across Oryza species

    • Higher sequence conservation in catalytic domains compared to regulatory regions

    • Subspecies-specific variations (indica vs. japonica) likely emerged during domestication events approximately 8,000-10,000 years ago

  • Selection pressure analysis:

    • Calculation of Ka/Ks ratios indicates purifying selection on catalytic domains

    • Variable selection pressure across different regions of the protein

    • Evidence of positive selection in regulatory regions, particularly in subspecies adapted to waterlogged conditions

  • Comparative genomics:

    • Synteny analysis shows conserved gene order around CSLC10 locus across Oryza species

    • Gene duplication events identified in some lineages, potentially conferring functional specialization

    • Structural variations (insertions/deletions) more common in promoter regions than coding sequences

  • Functional divergence:

    • Substrate specificity differences between species from different habitats

    • Expression pattern variations correlating with environmental adaptation

    • Differential interaction networks with other cell wall-related enzymes

This evolutionary context helps explain why certain landraces show superior adaptation to specific stresses, such as submergence tolerance in varieties like Poovan samba with elevated response indices , potentially linked to optimized cell wall remodeling mechanisms during stress.

What are the key methodological differences when studying xyloglucan glycosyltransferases from monocots versus dicots?

When studying xyloglucan glycosyltransferases from monocots (like rice) versus dicots (like Arabidopsis), researchers must account for several key methodological differences:

  • Cell wall composition differences:

    • Monocot primary walls: Type II (lower xyloglucan content, higher mixed-linkage glucans)

    • Dicot primary walls: Type I (higher xyloglucan content, no mixed-linkage glucans)

    • Extraction protocols must be optimized accordingly to account for these compositional differences

  • Extraction and purification adaptations:

    • Buffer compositions:

      • Monocots: Higher salt concentrations needed to disrupt stronger ionic interactions

      • Dicots: Standard extraction buffers often sufficient

    • Chromatographic separations:

      • Monocots: May require additional purification steps due to interfering compounds

      • Dicots: Typically cleaner extracts with established purification protocols

  • Activity assay considerations:

    • Substrate preferences vary between monocot and dicot enzymes:

      • Monocot enzymes: Often higher activity with XXXG-type oligosaccharides

      • Dicot enzymes: May prefer XXLG/XLLG-type oligosaccharides

    • Reaction conditions:

      • pH optima may differ (typically pH 5.0-5.5 for dicots vs. pH 5.5-6.0 for monocots)

      • Temperature optima variations (often higher for monocot enzymes)

  • Expression system selection:

    • For monocot proteins: Rice or maize cell suspension cultures provide more appropriate post-translational modifications

    • For dicot proteins: Arabidopsis or tobacco systems often preferred

When comparing results between monocot and dicot studies, researchers should account for these intrinsic differences to avoid misinterpretation of data. The fundamental mechanism of xyloglucan modification, involving cleavage and reconnection of cross-links , is conserved across plant lineages despite these methodological considerations.

How can xyloglucan glycosyltransferase activity be manipulated to improve specific agronomic traits in rice?

Manipulation of xyloglucan glycosyltransferase activity offers strategic approaches to enhance specific agronomic traits in rice:

  • Genetic engineering strategies:

    • Overexpression approaches:

      • Constitutive overexpression using strong promoters like CaMV 35S

      • Tissue-specific overexpression targeting stems for lodging resistance

      • Stress-inducible overexpression for conditional responses

    • Downregulation approaches:

      • RNAi-mediated silencing for reduced activity

      • CRISPR/Cas9 gene editing for precise mutations

      • Artificial microRNA targeting for fine-tuned regulation

  • Trait-specific manipulation strategies:

Agronomic TraitManipulation ApproachExpected OutcomeMolecular Mechanism
Lodging resistanceStem-specific overexpressionEnhanced stem strengthIncreased cross-linking of cell wall polymers
Drought toleranceStress-inducible expressionImproved water retentionModified cell wall elasticity maintaining turgor
Submergence toleranceConditional downregulationEnhanced elongation under submergenceReduced cell wall rigidity allowing faster growth
Pathogen resistanceTargeted cell wall modificationEnhanced barrier functionAltered accessibility of cell wall to pathogen enzymes
  • Screening methodologies:

    • High-throughput phenotypic screening of transgenic lines

    • Cell wall composition analysis using spectroscopic methods

    • Mechanical testing of plant tissues

    • Stress response assays under controlled conditions

  • Integration with breeding programs:

    • Marker-assisted selection for natural variants with optimal activity levels

    • Pyramiding with other stress-tolerance genes for synergistic effects

    • Field evaluation under multiple environments to ensure stability of the trait

This approach builds on observations from studies of rice landraces with varying submergence tolerance, where genotypes like Poovan samba demonstrated superior performance metrics including shoot length (35.76 cm) and response index (17.42) , potentially linked to optimal cell wall remodeling during stress.

What are the most significant technical challenges in crystallizing and determining the structure of recombinant xyloglucan glycosyltransferase 10?

Researchers face several significant technical challenges when attempting to crystallize and determine the structure of recombinant xyloglucan glycosyltransferase 10:

  • Protein production challenges:

    • Membrane association complicates purification

    • Expression in bacterial systems often leads to inclusion bodies

    • Eukaryotic expression systems yield limited quantities

    • Post-translational modifications critical for proper folding

  • Purification hurdles:

    • Maintaining enzyme stability during purification

    • Preventing aggregation during concentration

    • Removing detergents without precipitating protein

    • Achieving >95% purity required for crystallography

  • Crystallization difficulties:

    • Glycosylation heterogeneity hindering crystal formation

    • Dynamic domains creating conformational flexibility

    • Limited prior structural information for molecular replacement

    • Few established crystallization conditions for this enzyme family

  • Structure determination challenges:

    • Phase determination in the absence of homologous structures

    • Limited diffraction quality from initial crystals

    • Capturing catalytically relevant conformations

    • Resolving mobile loop regions involved in substrate binding

  • Methodological solutions:

    • Surface entropy reduction mutagenesis to enhance crystallization

    • Truncation constructs to remove flexible regions

    • Co-crystallization with substrates or inhibitors

    • Lipidic cubic phase crystallization for membrane-associated regions

    • Cryo-EM as alternative approach for difficult-to-crystallize conformations

These challenges explain why structural information for this enzyme family remains limited, despite their importance in plant cell wall biology and potential applications in rice improvement programs. The enzymes' molecular mass of approximately 33 kDa and glycoprotein nature further complicate structural studies.

What statistical approaches are most appropriate for analyzing xyloglucan glycosyltransferase activity across diverse rice germplasm?

When analyzing xyloglucan glycosyltransferase activity across diverse rice germplasm, researchers should employ these statistical approaches:

  • Descriptive statistics:

    • Calculate mean, median, range, and standard deviation of enzyme activity

    • Use box plots to visualize activity distribution across germplasm groups

    • Apply normality tests (Shapiro-Wilk) to determine appropriate parametric/non-parametric methods

  • Comparative analyses:

    • ANOVA with post-hoc tests (Tukey's HSD) for comparing multiple varieties

    • t-tests or Mann-Whitney U tests for comparing subspecies (indica vs. japonica)

    • Paired tests for comparing activity under different conditions (control vs. stress)

  • Association and correlation analyses:

    • Pearson or Spearman correlation between enzyme activity and quantitative traits

    • Cross-tabulation analysis for categorical variables

    • Multiple regression to identify predictors of enzyme activity

  • Multivariate approaches:

    • Principal Component Analysis (PCA) to reduce dimensionality of multi-trait datasets

    • Cluster analysis to identify groups with similar enzyme profiles

    • Discriminant analysis to classify varieties based on enzyme activity patterns

  • Example analysis workflow:

    • Test for normality of enzyme activity data

    • Apply appropriate transformation if needed (log, square root)

    • Conduct ANOVA to identify significant differences between variety groups

    • Calculate correlation coefficients with key agronomic traits

    • Generate cross-tabulation tables to examine relationships between categorical variables

    • Present results with appropriate significance indicators (p-values, confidence intervals)

These statistical approaches provide robust frameworks for interpreting enzyme activity data in the context of rice diversity, similar to methods used in analyzing traits like amylose content, gelatinization temperature, and gel consistency in rice quality studies .

How can researchers effectively interpret conflicting results when comparing CSLC10 function across different experimental systems?

When faced with conflicting results regarding CSLC10 function across different experimental systems, researchers should implement a systematic interpretive framework:

  • Systematic comparative analysis:

    • Create a comprehensive comparison table documenting:

      • Experimental system details (organism, cell type, conditions)

      • Protein forms used (full-length, truncated, tagged versions)

      • Assay methodologies and their limitations

      • Key findings and conflicting results

  • Methodological resolution approaches:

    • Assay sensitivity assessment:

      • Determine detection limits for each method

      • Evaluate potential for false positives/negatives

      • Compare signal-to-noise ratios across techniques

    • Substrate compatibility analysis:

      • Ensure substrate uniformity across studies

      • Evaluate potential for substrate batch variations

      • Assess buffer compatibility with enzyme activity

  • Biological context considerations:

    • Expression system differences:

      • Evaluate post-translational modifications

      • Consider membrane composition variations

      • Assess presence of interacting partners

    • Physiological relevance:

      • Compare in vitro vs. in vivo conditions

      • Consider developmental stage differences

      • Evaluate environmental factors (pH, temperature, ions)

  • Resolution strategies:

    • Perform side-by-side experiments using standardized protocols

    • Employ orthogonal techniques to validate findings

    • Conduct dose-response studies to identify threshold effects

    • Use genetic complementation to confirm functional equivalence

  • Integration and synthesis:

    • Develop working models that accommodate seemingly conflicting data

    • Identify conditional factors that explain divergent results

    • Prioritize evidence based on methodological rigor and biological relevance

By systematically addressing these factors, researchers can reconcile apparent contradictions and develop more nuanced understanding of CSLC10 function, similar to approaches used in reconciling data from various rice cultivars with different submergence tolerance mechanisms .

What emerging technologies hold the most promise for advancing our understanding of xyloglucan glycosyltransferase function in rice?

Several emerging technologies offer significant potential for advancing our understanding of xyloglucan glycosyltransferase function in rice:

  • Advanced genomic engineering:

    • CRISPR base editing for precise single nucleotide modifications

    • Prime editing for targeted insertions without double-strand breaks

    • Multiplexed CRISPR systems for simultaneous editing of multiple CSLC family members

    • Inducible CRISPR systems for temporal control of gene editing

  • High-resolution imaging technologies:

    • Super-resolution microscopy for nanoscale visualization of enzyme localization

    • Correlative light and electron microscopy (CLEM) linking protein location to ultrastructure

    • Live-cell imaging with fluorescent protein fusions to track dynamics

    • Expansion microscopy for enhanced visualization of cell wall architecture

  • Advanced spectroscopy and structural biology:

    • Cryo-electron microscopy for structure determination without crystallization

    • Solid-state NMR for studying enzyme-substrate interactions

    • Neutron scattering for analyzing cell wall architecture changes

    • Hydrogen-deuterium exchange mass spectrometry for protein dynamics

  • Systems biology approaches:

    • Multi-omics integration combining transcriptomics, proteomics, and metabolomics

    • Network modeling of cell wall synthesis pathways

    • Machine learning algorithms for predicting enzyme-substrate interactions

    • Synthetic biology circuits for controlled expression systems

  • Field-deployable phenotyping:

    • Hyperspectral imaging for non-destructive cell wall composition analysis

    • Portable mechanical testing devices for field assessment of stem properties

    • IoT-enabled growth monitoring correlated with gene expression

    • Drone-based phenotyping for large-scale field trials

These technologies promise to bridge current knowledge gaps, particularly in understanding how variations in CSLC10 contribute to diverse agronomic traits observed in rice varieties, such as the substantial differences in submergence tolerance noted between landraces like Poovan samba and Samba mosanam .

How might interdisciplinary approaches enhance our ability to translate CSLC10 research into improved rice varieties?

Interdisciplinary approaches offer powerful pathways to translate CSLC10 research into improved rice varieties:

  • Integrated research frameworks:

    • Molecular biology + Agronomic science:

      • Link molecular mechanisms to field performance

      • Design field trials specifically targeting cell wall-related traits

      • Develop high-throughput screening methods for cell wall properties

    • Biochemistry + Computational biology:

      • Model enzyme kinetics under varying environmental conditions

      • Predict substrate specificity through molecular docking

      • Simulate cell wall architecture with altered CSLC10 activity

    • Genetics + Climate science:

      • Identify CSLC10 variants adapted to specific environmental conditions

      • Predict performance under future climate scenarios

      • Develop climate-resilient varieties with optimized cell wall properties

  • Translational research pipeline:

Research PhaseDisciplines InvolvedKey ActivitiesExpected Outcomes
DiscoveryMolecular biology, BiochemistryGene characterization, Protein functionMechanistic understanding
ValidationGenetics, Plant physiologyTransgenic studies, Phenotypic analysisProof of concept
ApplicationBreeding, AgronomyMarker development, Field trialsPre-breeding materials
DeploymentExtension, Social sciencesFarmer participatory trials, Adoption studiesImproved varieties in farmers' fields
  • Collaborative frameworks:

    • Industry-academia partnerships for technology development

    • Public-private partnerships for varietal development

    • International collaborations connecting basic and applied researchers

    • Farmer-scientist participatory research networks

  • Knowledge management systems:

    • Integrated databases linking genotypic, phenotypic, and environmental data

    • Decision support tools for breeders selecting for cell wall traits

    • Open-access platforms for sharing protocols and germplasm

    • Cross-disciplinary training programs bridging molecular and field sciences

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.