Recombinant Oryza sativa subsp. indica UPF0496 protein 1 (OsI_010151)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
OsI_010151; UPF0496 protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-388
Protein Length
full length protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
OsI_010151
Target Protein Sequence
MGNSSSSGSHRPPRPASSESALPPAAAAAEELSSYEAACRSDPELRTFDTTLQRRTSRAI STLAVGVEVRSLSLESLREVTGCLLDMNQEVVRVILDCKKDIWKSPELFDLVEDYFESSL HTLDFCTALDKCLKRARDSQLLLHVALQRFDDEEDNDAAAAGQEDAAPSARYARTLHELR QFKAAGDPFTEEFFSAFQAVYRQQLTMLEKLQQRKHRLDKKVRAIKAWRRVSSIIFATTF AAVLICSVVAAAIAAPPVAAALAAAASIPVGSMGKWIDSLLKGYQDALRGQKEVVSAMQV GTFIAIKDLDSIRVLINRVELEISSMIDCVEFAERDEEAVKFGVEEIKKKLEVFMKSVED LGEQADRCSRDIRRARTVVLQRIIRHPS
Uniprot No.

Target Background

Protein Families
UPF0496 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Oryza sativa subsp. indica UPF0496 protein 1?

UPF0496 protein 1 (OsI_010151) is a member of the UPF0496 protein family found in Oryza sativa subsp. indica (rice). Similar to other UPF0496 proteins such as OsI_023618, it is characterized as a putative protein with specific amino acid sequences that can be expressed recombinantly for research purposes. While the exact function remains under investigation, it belongs to a family of proteins that may be involved in plant growth, development, and stress responses .

How is recombinant OsI_010151 typically expressed and purified?

Recombinant OsI_010151 is commonly expressed in E. coli expression systems, similar to other UPF0496 family members. The protein can be fused with affinity tags such as His-tags to facilitate purification. The expression typically involves transforming E. coli with a vector containing the OsI_010151 gene sequence, inducing expression, and then purifying using affinity chromatography. After purification, the protein is often obtained as a lyophilized powder that requires reconstitution in an appropriate buffer system with potential addition of glycerol (5-50%) for long-term storage .

What are the optimal storage conditions for recombinant OsI_010151?

Based on protocols for similar proteins in the UPF0496 family, recombinant OsI_010151 should be stored at -20°C to -80°C upon receipt, with aliquoting recommended for multiple use to avoid repeated freeze-thaw cycles. For working aliquots, storage at 4°C for up to one week is generally acceptable. The protein is typically maintained in a Tris/PBS-based buffer containing approximately 6% trehalose at pH 8.0 to ensure stability .

How does OsI_010151 relate to the rice interactome network?

While specific interactions of OsI_010151 are not directly detailed in the search results, it likely participates in the rice protein-protein interaction network similar to other rice proteins. The Predicted Rice Interactome Network (PRIN) has identified over 76,585 predicted interactions involving 5,049 rice proteins. Understanding OsI_010151's position within this network would require mapping its interactions using computational prediction methods followed by experimental validation, as has been done for other rice proteins .

What is the recommended reconstitution protocol for lyophilized OsI_010151?

For reconstitution of lyophilized OsI_010151, researchers should briefly centrifuge the vial before opening to ensure all material is at the bottom. The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, it is recommended to add glycerol to a final concentration of 5-50% (with 50% being standard in many protocols) before aliquoting and storing at -20°C/-80°C. This process helps maintain protein stability and prevents degradation during freeze-thaw cycles .

How can researchers verify the purity and activity of recombinant OsI_010151?

Purity verification of recombinant OsI_010151 should be conducted using SDS-PAGE analysis, with expected purity greater than 90%. For activity assessment, functional assays specific to the protein's role should be developed. Since UPF0496 proteins may be involved in stress responses or developmental processes, researchers might consider:

  • Protein-protein interaction assays (e.g., pull-down assays or yeast two-hybrid screens)

  • In vitro activity assays based on predicted functional domains

  • Complementation studies in knockout/knockdown rice plants

Mass spectrometry can also be used to confirm the protein's identity and integrity, particularly when amino acid sequencing is required for protein identification when genome sequence information is limited .

What methods are suitable for studying OsI_010151 expression patterns under stress conditions?

Based on proteomic approaches used for other rice proteins, researchers can study OsI_010151 expression patterns under stress conditions using:

  • Two-dimensional gel electrophoresis (2D-GE) followed by mass spectrometry for protein identification and quantification

  • Western blotting with specific antibodies against OsI_010151

  • Real-time PCR to measure transcript levels

When studying stress responses (such as UV-B stress), controlled environment chambers like Sunlit Soil-Plant-Atmosphere-Research (SPAR) chambers can be used to mimic natural conditions while precisely controlling stress levels. These approaches allow researchers to observe how OsI_010151 expression changes in response to environmental stressors, potentially revealing its role in stress adaptation mechanisms .

How can OsI_010151 protein complexes be identified and characterized?

To identify and characterize OsI_010151 protein complexes, researchers can employ several advanced techniques:

  • Co-immunoprecipitation (Co-IP) followed by mass spectrometry

  • Proximity-dependent biotin identification (BioID) or proximity ligation assay (PLA)

  • Native PAGE combined with western blotting

  • Crosslinking mass spectrometry (XL-MS)

The identified interactions should be validated using techniques like bimolecular fluorescence complementation (BiFC) or Förster resonance energy transfer (FRET). Additionally, results can be compared with predictions from the Predicted Rice Interactome Network (PRIN) database, which already contains 76,585 predicted interactions involving 5,049 rice proteins. This integrated approach allows for comprehensive mapping of OsI_010151's interaction network and functional protein complexes .

What bioinformatic approaches can predict the function of OsI_010151?

Predicting the function of OsI_010151 requires sophisticated bioinformatic analyses, including:

  • Sequence homology analysis with functionally characterized proteins

  • Domain structure prediction and comparison with known protein families

  • Gene Ontology (GO) term enrichment analysis

  • Protein-protein interaction network analysis using PRIN database

  • Co-expression analysis with genes of known function

  • Subcellular localization prediction

These analyses can be integrated to provide insights into potential cellular pathways and biological processes involving OsI_010151. When combined with experimental validation, this approach has been shown to effectively expand knowledge about protein function and coordination within gene networks in rice .

How does OsI_010151 respond to abiotic stresses compared to other UPF0496 family members?

Analyzing OsI_010151's response to abiotic stresses requires comparative proteomic analysis similar to studies performed on other rice proteins. The differential expression of OsI_010151 under various stress conditions (e.g., UV-B radiation, drought, temperature extremes) can be compared to other UPF0496 family members using:

  • 2D-GE coupled with mass spectrometry to identify differentially expressed proteins

  • Quantitative proteomics approaches such as iTRAQ or TMT labeling

  • Selected reaction monitoring (SRM) for targeted protein quantification

Different rice cultivars (e.g., IR6 and REX) may show varying levels of UPF0496 protein expression under stress, potentially correlating with stress tolerance. For example, studies on UV-B stress showed that REX cultivar had 45% differentially expressed proteins while IR6 had only 27.5%, indicating cultivar-specific stress responses .

What is the role of OsI_010151 in the rice redox homeostasis network during stress?

While specific information about OsI_010151 in redox homeostasis is not provided in the search results, its potential role can be investigated using methods similar to those used for other rice proteins:

  • Analysis of protein abundance changes in response to oxidative stress

  • Examination of post-translational modifications related to redox status (e.g., carbonylation, glutathionylation)

  • Assessment of interactions with known redox-related proteins

Proteins involved in redox homeostasis, such as superoxide dismutase, peroxidase precursors, and pathogenesis-related proteins, have been shown to increase in abundance under UV-B stress in rice. Determining whether OsI_010151 displays similar expression patterns or interacts with these proteins would provide insights into its potential role in redox regulation during stress responses .

How can researchers address the challenge of low-abundance OsI_010151 in native tissues?

Working with low-abundance proteins like OsI_010151 in native tissues presents significant challenges. Researchers can implement the following strategies:

  • Employ enrichment techniques such as subcellular fractionation to concentrate the protein from specific cellular compartments

  • Use mass spectrometry with higher sensitivity, such as selected reaction monitoring (SRM) or parallel reaction monitoring (PRM)

  • Develop enhanced extraction protocols optimized for rice tissues

  • Implement immunoprecipitation with highly specific antibodies for protein concentration

Mass spectrometry has been successfully used for de novo peptide sequencing of low-abundance proteins isolated from two-dimensional gels, as demonstrated in studies with other plant proteins. This approach enables protein identification even when the protein is present at low levels .

What approaches can resolve contradictory data when studying OsI_010151 interactions?

When faced with contradictory data regarding OsI_010151 interactions, researchers should implement a systematic resolution approach:

  • Verify protein identity using multiple methods (mass spectrometry, western blotting)

  • Test interactions under varied experimental conditions (pH, salt concentration, temperature)

  • Employ multiple interaction detection methods (Y2H, Co-IP, BiFC) and compare results

  • Consider post-translational modifications that might affect interactions

  • Investigate tissue-specific or condition-specific interaction patterns

For example, in the PRIN database, 230 predicted interactions were found to overlap with 66 interactions in the experimental network, with 20 confirmed experimentally. This demonstrates that computational predictions and experimental results may differ but can be reconciled through systematic validation approaches .

How can researchers differentiate between the functions of OsI_010151 and related UPF0496 family members?

Differentiating the specific functions of OsI_010151 from other UPF0496 family members requires multiple complementary approaches:

  • Generate knockout/knockdown lines specific to individual UPF0496 genes using CRISPR-Cas9 or RNAi

  • Perform phenotypic analyses of mutant lines under various conditions

  • Conduct complementation studies with individual family members

  • Compare protein-protein interaction networks of different family members

  • Analyze expression patterns across tissues and developmental stages

  • Examine evolutionary conservation across different rice varieties and related species

Proteins of the same family may appear as different spots in proteomic analyses, representing different isoforms regulated in distinct ways or post-translationally modified forms. This phenomenon has been observed in rice proteomic studies where proteins like chlorophyll A-B binding protein appeared as multiple spots with different expression patterns under stress conditions .

How might CRISPR-Cas9 gene editing be used to study OsI_010151 function in vivo?

CRISPR-Cas9 gene editing offers powerful approaches to study OsI_010151 function:

  • Generate knockout rice lines by introducing frameshift mutations in the OsI_010151 gene

  • Create knock-in lines with reporter tags (GFP, FLAG) for tracking protein localization and dynamics

  • Introduce point mutations in specific domains to assess their functional importance

  • Develop promoter modifications to alter expression patterns

The resulting transgenic lines should undergo comprehensive phenotyping, including:

Analysis TypeParameters MeasuredRelevance to OsI_010151 Function
MorphologicalPlant height, tillering, leaf architectureGrowth and developmental roles
PhysiologicalPhotosynthetic rate, stomatal conductanceMetabolic functions
Stress ResponseROS accumulation, antioxidant enzyme activityRole in stress adaptation
MolecularTranscriptome and proteome alterationsDownstream effects of OsI_010151 disruption

This approach would provide direct evidence of OsI_010151's function and its role in rice development and stress responses .

What potential applications exist for OsI_010151 in improving rice stress tolerance?

Based on studies of other stress-responsive proteins in rice, potential applications for OsI_010151 include:

  • Development of molecular markers for stress tolerance in breeding programs

  • Creation of transgenic rice with modified OsI_010151 expression for enhanced stress resilience

  • Use as a biomarker for early detection of stress responses

  • Identification of chemical compounds that modulate OsI_010151 activity for stress protection

If OsI_010151 functions similarly to other proteins identified in stress studies, it might play roles in processes like photosynthesis regulation, redox homeostasis, or cell wall architecture modifications. For example, proteins like glycosyl hydrolase (affecting cell wall architecture) and glyceraldehyde-3-phosphate dehydrogenase (involved in energy production) have been identified as important in rice stress responses .

How could comparative proteomics across rice varieties enhance our understanding of OsI_010151 evolution and function?

Comparative proteomics across rice varieties offers valuable insights into OsI_010151 evolution and function:

  • Analyze OsI_010151 sequence conservation and variation across indica, japonica, and wild rice species

  • Compare protein abundance and post-translational modifications in different varieties

  • Correlate OsI_010151 expression patterns with stress tolerance phenotypes

  • Identify variety-specific interaction partners

Studies comparing proteomes of different rice cultivars (e.g., Japonica REX and Indica IR6) under stress conditions have revealed cultivar-specific protein expression patterns. For example, under UV-B stress, REX showed 45% differentially expressed proteins while IR6 had only 27.5%, with only 11% common to both cultivars. Applying similar approaches to study OsI_010151 across varieties could reveal its evolutionary adaptation and functional diversity in the rice gene pool .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.