Recombinant Oryza sativa subsp. indica UPF0496 protein 4 (OsI_033149)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
OsI_033149; UPF0496 protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-456
Protein Length
full length protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
OsI_033149
Target Protein Sequence
MSRAHGSPRSFFPVGNPFRVMFPGGAHLSRKLQELLASYEDALALSLRKLKPEAASDVLT LSWMRLAVDCLSELHTNIANLITDLELPVSDWDDKWVDIYLNSSVKLLDICIALSSELSR LDQGQLLLQYALHVLGSESGVPSQEQLKRAEPSLREWMELVGVRCPRLVSCSATLQELAG NLSLMKVKNSVKGKVLMRALYGIESVTVFVCSIFVAVLSGSPKPLVELHVPEKFGWSQAF NDLHTAVSEELTRQLAGGSVAAVKELEEVEACAKRLHVLASTSQLEEEAANLANAVSHTE EEVMSDSIVQEGDHHCGLKLADDTTRECEVVISESIAEEGTHEAEMKKDISYEKGVAMVE RISYEEHQDSNVKQANGSSDESALVVPERTSVQESKEELLNCISSMSKSAEGLRHGLDSL SKRVGDFFQIVLTGRDALLCNLRISDAASKVAEVSS
Uniprot No.

Target Background

Protein Families
UPF0496 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What expression systems are optimal for producing Recombinant Oryza sativa subsp. indica UPF0496 protein 4?

While multiple expression systems can be employed for recombinant protein production, the choice depends on research objectives and desired protein characteristics. For Recombinant Oryza sativa subsp. indica UPF0496 protein 4, both prokaryotic and eukaryotic systems have demonstrated efficacy, each with distinct advantages.

E. coli systems are commonly used due to their high yield and relatively straightforward protocols. This approach has been successfully applied to related proteins, such as the Recombinant Full Length Oryza sativa subsp. indica Putative UPF0496 protein 2 (OsI_023618) . For more complex applications requiring proper post-translational modifications, mammalian expression systems like HEK293E cells present advantages despite their higher complexity and cost.

The HEK293E expression system is particularly notable for high-yield recombinant protein production. A modified protocol combining PEI-based transfection with optimized gene expression vectors can yield titers exceeding 1 g/l . This represents a significant advancement over traditional methods, which typically produce much lower yields.

How should researchers approach the purification of Recombinant Oryza sativa subsp. indica UPF0496 protein 4?

Purification of Recombinant Oryza sativa subsp. indica UPF0496 protein 4 requires a strategic approach based on its physical and chemical properties. When expressed with an affinity tag such as a polyhistidine tag, immobilized metal affinity chromatography (IMAC) serves as an effective initial purification step. This approach has been successfully implemented with similar proteins such as the His-tagged Recombinant Full Length Oryza sativa subsp. indica Putative UPF0496 protein 2 .

Following the initial affinity purification, researchers should consider employing size exclusion chromatography to further enhance protein purity and remove potential aggregates. For applications requiring exceptionally high purity, ion exchange chromatography may be implemented as an additional purification step, with buffer conditions adjusted according to the protein's isoelectric point.

The purification process should conclude with quality control assessments, including SDS-PAGE to verify purity (>90% is typically considered acceptable for most research applications) and mass spectrometry to confirm protein identity and integrity .

How can vector design be optimized for high-yield production of Recombinant Oryza sativa subsp. indica UPF0496 protein 4?

Optimizing vector design for high-yield production of Recombinant Oryza sativa subsp. indica UPF0496 protein 4 requires a multifaceted approach focusing on promoter selection, codon optimization, and the incorporation of enhancer elements. Research has demonstrated that rational vector design significantly impacts recombinant protein yields in mammalian expression systems.

When designing expression vectors for HEK293E cells, the human CMV enhancer/promoter has shown superior performance compared to mouse CMV and human eIF1α promoters . Further optimization through the introduction of introns and woodchuck post-transcriptional regulatory elements (WPRE) can substantially enhance expression levels. The resulting optimized vectors (such as pXLG) have demonstrated capacity for exceptional protein yields.

For maximum expression efficiency in mammalian systems, a strategic combination of plasmids can be employed:

Plasmid ComponentProportion (w/w)Function
Expression vector containing target gene75%Expresses the recombinant protein of interest
Cell cycle regulator (p18h)10%Modulates cell cycle to enhance productivity
Cell cycle regulator (p21h)10%Complements p18h for optimal cell cycle control
Growth factor (aFGF)5%Enhances cell viability and productivity

This multi-plasmid approach has demonstrated dramatic increases in recombinant protein titers, achieving up to 27-fold improvement from 40 mg/l to 1.1 g/l in optimized systems .

What experimental approaches are effective for elucidating the function of UPF0496 protein 4 in rice signaling pathways?

Elucidating the function of UPF0496 protein 4 in rice signaling pathways requires a comprehensive experimental strategy incorporating genomic, transcriptomic, proteomic, and phenotypic analyses. The UPF0496 protein family's role in plant signaling remains incompletely characterized, necessitating systematic investigation.

Comparative genomic analysis between Oryza sativa and model organisms with well-characterized signaling pathways, such as Arabidopsis thaliana, can provide initial insights into potential functions. Whole-genome studies have revealed similarities in two-component signaling (TCS) machinery architecture between rice and Arabidopsis, suggesting conserved signaling mechanisms that may involve UPF0496 proteins .

Protein-protein interaction studies using techniques such as yeast two-hybrid screening, co-immunoprecipitation, or proximity labeling can identify binding partners of UPF0496 protein 4, potentially placing it within established signaling networks. These experiments should be complemented with subcellular localization studies to determine the protein's distribution within plant cells, providing additional context for its potential functions.

CRISPR-Cas9 mediated gene knockout or RNAi-based gene silencing of OsI_033149 can generate loss-of-function phenotypes that may reveal the protein's physiological roles. Subsequent transcriptomic analysis of these modified plants under various conditions (e.g., abiotic stress, hormone treatment) can further elucidate the pathways affected by UPF0496 protein 4 absence.

What are the optimal storage conditions for maintaining stability of Recombinant Oryza sativa subsp. indica UPF0496 protein 4?

Maintaining the stability of Recombinant Oryza sativa subsp. indica UPF0496 protein 4 requires careful attention to storage conditions. For long-term storage, the protein should be maintained at -20°C or preferably -80°C in an appropriate buffer system . The recommended storage buffer typically includes a Tris-based formulation with 50% glycerol, which has been optimized to preserve protein structure and function .

For working solutions, aliquots should be prepared to avoid repeated freeze-thaw cycles, which can significantly compromise protein integrity. These aliquots can be stored at 4°C for up to one week . When reconstituting lyophilized protein preparations, it is advisable to use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL, followed by the addition of glycerol to a final concentration of 50% for preparations intended for long-term storage .

The stability of the protein under experimental conditions should be verified through activity assays or structural analyses at regular intervals to ensure that degradation has not occurred. This is particularly important for functional studies where protein activity is essential for valid results.

How can researchers evaluate the structural characteristics of UPF0496 protein 4 in relation to its potential functions?

Evaluating the structural characteristics of UPF0496 protein 4 requires a multi-technique approach that combines computational prediction with experimental validation. The process should begin with comprehensive sequence analysis, including alignment with structurally characterized homologs, motif identification, and secondary structure prediction using algorithms such as PSIPRED or JPred.

For tertiary structure determination, X-ray crystallography represents the gold standard approach, providing atomic-level resolution of protein structure. Sample preparation for crystallography would involve:

  • Purification to >95% homogeneity using affinity chromatography followed by size exclusion

  • Concentration to 5-15 mg/ml in a crystallization buffer

  • Screening of crystallization conditions using commercial sparse matrix screens

  • Optimization of promising conditions and data collection at synchrotron radiation facilities

Alternative approaches include nuclear magnetic resonance (NMR) spectroscopy for smaller domains of the protein and cryo-electron microscopy for larger assemblies or complexes. Additionally, hydrogen-deuterium exchange mass spectrometry can provide insights into dynamic regions and potential binding interfaces.

Functional regions can be mapped through systematic mutagenesis of conserved residues identified through sequence alignment across species. Each mutant should be assessed for alterations in biochemical properties, binding interactions, or cellular phenotypes when expressed in appropriate systems.

What quality control parameters should be established for Recombinant Oryza sativa subsp. indica UPF0496 protein 4 preparations?

Establishing rigorous quality control parameters is essential for ensuring consistency and reliability in experiments utilizing Recombinant Oryza sativa subsp. indica UPF0496 protein 4. A comprehensive quality control protocol should include multiple analytical techniques to assess purity, identity, quantity, and activity.

Purity assessment should be performed using SDS-PAGE with densitometric analysis, with a minimum acceptable threshold of 90% purity . This should be complemented by more sensitive techniques such as capillary electrophoresis or high-performance liquid chromatography (HPLC) for detection of minor contaminants.

Protein identity confirmation requires mass spectrometry analysis, preferably using both intact mass measurement and peptide mapping following protease digestion. The experimental mass should be compared to the theoretical mass calculated from the amino acid sequence, accounting for any post-translational modifications or affinity tags.

Endotoxin testing is critical for preparations intended for cell-based assays or in vivo studies, with acceptable levels typically below 1 EU/mg protein. Aggregation state should be assessed using dynamic light scattering or analytical size exclusion chromatography to ensure monodispersity of the protein preparation.

For functional validation, activity assays should be developed based on the protein's predicted functions or binding interactions, providing a quantitative measure of the preparation's biological activity.

How can researchers investigate the role of UPF0496 protein 4 in plant stress responses?

Investigating the role of UPF0496 protein 4 in plant stress responses requires a systematic experimental design that examines both gene expression patterns and phenotypic consequences under various stress conditions. The research approach should incorporate both in vitro and in vivo methodologies to comprehensively characterize the protein's function.

Stress ConditionTreatment DurationTissue SampledAnalysis Method
Drought (20% field capacity)0, 6, 12, 24, 48, 72 hoursLeaves, RootsRNA-seq, RT-qPCR
Salt (150mM NaCl)0, 3, 6, 12, 24, 48 hoursLeaves, RootsRNA-seq, RT-qPCR
Cold (4°C)0, 6, 12, 24, 48 hoursWhole seedlingsRNA-seq, RT-qPCR
Bacterial infection0, 12, 24, 48, 72 hoursLeavesRNA-seq, RT-qPCR

Transgenic rice lines overexpressing UPF0496 protein 4 or CRISPR-Cas9 knockout lines should be generated and subjected to stress tolerance assays. Phenotypic parameters including growth rate, photosynthetic efficiency, membrane integrity, and metabolite composition can be measured to assess stress response differences between transgenic and wild-type plants.

Protein localization studies using fluorescent protein fusions should be conducted under normal and stress conditions to determine if subcellular redistribution occurs in response to stress, potentially indicating regulatory functions.

What are the emerging technologies that could advance our understanding of UPF0496 protein 4 function?

Emerging technologies offer promising avenues for deeper investigation into UPF0496 protein 4 function. Single-cell transcriptomics represents a particularly powerful approach, enabling researchers to map expression patterns across different cell types in rice tissues with unprecedented resolution. This could reveal cell-specific roles for UPF0496 protein 4 that might be masked in bulk tissue analyses.

CRISPR-based technologies beyond gene knockout, such as CRISPRa (activation) and CRISPRi (interference), allow for more nuanced manipulation of gene expression. Base editing and prime editing technologies enable precise single-nucleotide modifications, facilitating the creation of specific mutations to test structure-function hypotheses without disrupting the entire gene.

Integrative multi-omics approaches combining transcriptomics, proteomics, metabolomics, and phenomics data can provide a systems-level understanding of UPF0496 protein 4's role in rice biology. Machine learning algorithms can be applied to these complex datasets to identify patterns and generate testable hypotheses about protein function.

AlphaFold2 and other AI-based structural prediction tools offer increasingly accurate protein structure models, which could inform functional predictions for UPF0496 protein 4 even in the absence of experimental structural data .

How can comparative studies between UPF0496 family members advance our understanding of their collective functions?

Comparative studies between members of the UPF0496 protein family can significantly advance our understanding of their evolutionary relationships, conserved functions, and species-specific adaptations. The UPF0496 family includes at least four members in Oryza sativa subsp. indica, including UPF0496 protein 4 (OsI_033149) and UPF0496 protein 2 (OsI_023618) .

Comparative expression profiling across different developmental stages, tissues, and environmental conditions can reveal patterns of functional specialization or redundancy among family members. Coordinated expression patterns may suggest involvement in common processes, while divergent expression could indicate functional diversification.

Domain swapping experiments between different UPF0496 family members can identify regions responsible for specific functions or interactions. By creating chimeric proteins and assessing their activity in appropriate assays, researchers can map functional domains with precision.

Complementation studies in knockout lines can determine the extent of functional redundancy among family members. For example, expressing UPF0496 protein 2 in a UPF0496 protein 4 knockout background can reveal whether these proteins share overlapping functions or have evolved distinct roles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.