Recombinant Oryza sativa subsp. indica UPF0603 protein OsI_019212, chloroplastic (OsI_19898)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Oryza sativa subsp. indica UPF0603 protein OsI_019212, chloroplastic (OsI_19898), is a protein derived from Oryza sativa subsp. indica (rice), specifically engineered and produced using recombinant DNA technology . This protein, also known as UPF0603 protein OsI_019212, chloroplastic, is associated with the chloroplast and belongs to the UPF0603 protein family . Recombinant proteins are produced by introducing the gene encoding the protein into a host organism, such as E. coli, which then expresses the protein .

Protein Information

The recombinant full-length Oryza sativa subsp. indica UPF0603 protein OsI_019212, chloroplastic (OsI_19898) has the following characteristics :

Table 1: Protein Characteristics

CharacteristicDescription
Gene NameOsI_19898
SynonymsOsI_19898; UPF0603 protein OsI_019212, chloroplastic
UniProt IDA2Y4G9
SpeciesRice (Oryza sativa subsp. indica)
SourceE. coli
TagHis (N-terminal)
Protein LengthFull Length of Mature Protein (99-299 amino acids)
AA SequenceSEFDVLNGGPPEDTYVVDDAGVLSRVTKSDVKRLVRDLESRKNIRINFITVRKLTSKADAFEYADQVLEKWYPTVEEGNNKGIVVLVTSQKEGAITGGPAFVQAVGDEILDSTVSENLPV LATDEKYNEAIYTTAKRLAAAIDGLPDPGGPTFKDNKRESNFKTKEETEEKRGQFTLVVGGLLVIAFVVPMAQYYAYISKK
PurityGreater than 90% as determined by SDS-PAGE
FormLyophilized powder
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃.

Gene Information

The gene encoding this protein is designated as OsI_19898 . It is also known as UPF0603 protein OsI_019212, chloroplastic. The protein sequence is available under the UniProt ID A2Y4G9 .

Expression and Localization

Studies show that the native Oryza sativa cpSRP43 (OscpSRP43) is constitutively expressed in various organs of the rice plant, with the highest levels of expression found in the leaves . Subcellular localization studies using techniques such as TargetP and ChloroP indicate that OscpSRP43 is located in the chloroplast . This was confirmed through transient expression assays using rice protoplasts, where the OscpSRP43:GFP fusion protein was found to be co-localized with chlorophylls in the chloroplasts .

Function

The function of UPF0603 protein OsI_019212, chloroplastic (OsI_19898) is not yet clearly defined. Proteins containing the UPF0603 domain are found in plants and bacteria, but their specific roles often remain uncharacterized, highlighting the need for further research to elucidate their functions.

Role in Chloroplast Development and Photosynthesis

Oryza sativa cpSRP43 (OscpSRP43) is required for normal chloroplast development and photosynthesis in rice . A rice chlorophyll-deficient mutant w67, which exhibited distinct yellow-green leaves with reduced levels of photosynthetic pigments, abnormal chloroplast development, and impaired photosynthesis compared with the wild type, was studied . The mutant phenotype was controlled by a single recessive nuclear gene, and a single base substitution in the chloroplast-targeted signal recognition particle 43 (cpSRP43) gene was responsible for the yellow-green phenotype .

Potential Applications

Recombinant Oryza sativa subsp. indica UPF0603 protein OsI_019212, chloroplastic (OsI_19898) can be utilized in various research applications including:

  • ELISA assays: It can be used as an antigen in Enzyme-Linked Immunosorbent Assays (ELISA) for detecting and quantifying antibodies against this protein .

  • Protein interaction studies: To identify interacting partners and understand its role in protein complexes .

  • Structural studies: To determine the three-dimensional structure of the protein, providing insights into its function.

  • Functional assays: To investigate its biochemical activities and its role in chloroplast function .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
OsI_19898; UPF0603 protein OsI_019212, chloroplastic
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
99-299
Protein Length
Full Length of Mature Protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
OsI_19898
Target Protein Sequence
SEFDVLNGGPPEDTYVVDDAGVLSRVTKSDVKRLVRDLESRKNIRINFITVRKLTSKADA FEYADQVLEKWYPTVEEGNNKGIVVLVTSQKEGAITGGPAFVQAVGDEILDSTVSENLPV LATDEKYNEAIYTTAKRLAAAIDGLPDPGGPTFKDNKRESNFKTKEETEEKRGQFTLVVG GLLVIAFVVPMAQYYAYISKK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0603 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein; Lumenal side.

Q&A

What expression systems are used for producing recombinant OsI_19898?

Recombinant OsI_19898 is predominantly expressed in E. coli expression systems with an N-terminal His-tag fusion to facilitate purification. The protein is expressed as a mature form (residues 99-299) without the chloroplastic transit peptide to improve solubility and yield . When designing expression constructs, researchers should consider:

Expression ParameterRecommended Conditions
Expression systemE. coli (BL21 or Rosetta strains)
Fusion tagN-terminal His tag
Expression regionMature protein (99-299)
Induction temperature16-25°C (lower temperatures improve solubility)
Induction time12-18 hours
Purification methodNickel affinity chromatography

Alternative expression systems such as insect cells may be considered for applications requiring eukaryotic post-translational modifications, though the bacterial system yields sufficient functional protein for most research applications .

What are the optimal storage and handling conditions for recombinant OsI_19898?

For optimal stability and activity of recombinant OsI_19898, researchers should adhere to the following storage and handling protocols:

Storage ParameterRecommended Conditions
Long-term storage-20°C to -80°C (prefer -80°C for extended periods)
Working aliquots4°C for up to one week
Storage bufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution bufferDeionized sterile water
Recommended concentration0.1-1.0 mg/mL
CryoprotectantAdd glycerol to 5-50% final concentration

To minimize protein degradation: avoid repeated freeze-thaw cycles, aliquot upon receipt, and briefly centrifuge vials before opening to collect contents . For experiments requiring multiple uses, storing multiple small aliquots is strongly recommended over repeated thawing of a single stock.

What methods are recommended for assessing protein purity and identity?

To confirm the purity, identity, and integrity of recombinant OsI_19898, employ multiple complementary analytical techniques:

  • SDS-PAGE analysis: The protein should demonstrate >90% purity with a single predominant band at approximately 22-23 kDa plus the contribution of the His-tag .

  • Western blotting: Use anti-His antibodies to confirm the presence of the N-terminal His-tag and verify protein identity.

  • Mass spectrometry: For precise molecular weight determination and peptide mapping to confirm sequence integrity.

  • Size-exclusion chromatography: To assess aggregation state and homogeneity of the preparation.

  • Circular dichroism (CD): To evaluate secondary structure content and proper folding.

These methods collectively provide comprehensive characterization necessary for ensuring reproducible experimental results across different protein preparations .

How can researchers optimize reconstitution protocols for maximum protein activity?

For optimal reconstitution of lyophilized OsI_19898:

  • Centrifuge the vial briefly before opening to ensure all protein is collected at the bottom.

  • Reconstitute using deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • For applications where higher protein concentration is required, reconstitute in a smaller volume of buffer and determine the maximum solubility empirically.

  • For long-term storage of reconstituted protein, add glycerol to a final concentration of 5-50% (optimally 50%) to prevent freezing damage .

  • If protein precipitation occurs during reconstitution, try alternative buffers with different salt concentrations (150-500 mM NaCl) or pH values (6.5-8.5).

Reconstitution conditions may need to be optimized depending on the specific experimental application and downstream compatibility requirements.

What techniques are recommended for investigating potential binding partners of OsI_19898?

To identify and characterize potential interaction partners of OsI_19898, researchers should employ multiple complementary techniques:

  • Pull-down assays: Using His-tagged recombinant protein as bait with rice chloroplast extracts, followed by mass spectrometry to identify interacting proteins.

  • Yeast two-hybrid (Y2H) screening: Construct bait plasmids containing the UPF0603 coding sequence to screen against rice cDNA libraries.

  • Surface Plasmon Resonance (SPR): Immobilize purified recombinant protein to quantitatively measure binding kinetics with potential partners.

  • Nucleic acid binding assays: Test for DNA/RNA binding activity using electrophoretic mobility shift assays (EMSA), as other rice proteins with similar localization have demonstrated nucleic acid binding capabilities .

  • Co-immunoprecipitation: Generate antibodies against the native protein for precipitation experiments with plant extracts.

When designing these experiments, it's critical to consider the native chloroplastic environment and use buffers that mimic physiological conditions to minimize artificial interactions.

How can researchers investigate the potential role of OsI_19898 in stress response?

Based on findings with other chloroplastic proteins in rice, OsI_19898 may have roles in stress response that can be investigated through:

  • Expression analysis: Quantify transcript and protein levels under various stress conditions (cold, heat, drought, salt) using qRT-PCR and Western blotting. Unlike some cold shock domain proteins that show transient upregulation of transcripts with sustained protein levels during stress , OsI_19898 may display unique expression patterns.

  • Transgenic approaches:

    • Overexpression studies: Generate transgenic rice overexpressing OsI_19898 and assess stress tolerance phenotypes

    • Knockdown/knockout studies: Use CRISPR-Cas9 or RNAi to reduce expression and evaluate impacts on stress susceptibility

  • Functional complementation: Test if OsI_19898 can complement stress-sensitive mutants in model organisms, similar to experiments with other rice proteins that complemented cold-sensitive bacterial strains .

  • Chloroplast function analysis: Examine photosynthetic parameters, chloroplast ultrastructure, and reactive oxygen species levels in plants with altered OsI_19898 expression under stress conditions.

The experimental design should account for potential tissue-specific responses, particularly in reproductive tissues and meristematic regions where stress-responsive proteins often accumulate .

What approaches can determine the subcellular localization and trafficking of OsI_19898?

To confirm and characterize the chloroplastic localization of OsI_19898:

  • Fluorescent protein fusion: Generate constructs expressing OsI_19898 fused to GFP or other fluorescent proteins to visualize localization in planta through confocal microscopy.

  • Immunolocalization: Develop specific antibodies against OsI_19898 for immunogold labeling and electron microscopy to determine precise sub-organellar localization.

  • Chloroplast fractionation: Isolate intact chloroplasts and separate thylakoid, stromal, and envelope fractions to determine where OsI_19898 predominantly associates.

  • Import assays: Perform in vitro chloroplast import assays to confirm the functionality of the transit peptide and processing to the mature form.

  • Peptide mapping: Determine the exact cleavage site of the transit peptide through N-terminal sequencing of the mature protein isolated from chloroplasts.

These approaches will provide insight into the protein's native environment and potential functional associations with specific chloroplast compartments or complexes.

How can comparative genomics and evolutionary analysis inform OsI_19898 research?

Comparative genomics approaches provide valuable context for understanding OsI_19898 function:

  • Phylogenetic analysis: Construct phylogenetic trees of UPF0603 family proteins across plant species to identify evolutionary relationships and potential functional divergence.

  • Synteny analysis: Examine genomic regions surrounding OsI_19898 orthologs to identify conserved gene clusters that might indicate functional relationships.

  • Selective pressure analysis: Calculate Ka/Ks ratios across different plant lineages to identify regions under positive or purifying selection.

  • Domain architecture comparison: Analyze the conservation of protein domains and motifs across species to identify functionally important regions.

  • Expression pattern comparison: Compare tissue-specific and stress-responsive expression patterns of OsI_19898 orthologs across species to identify conserved regulatory mechanisms.

These analyses can reveal evolutionary constraints and adaptations that provide clues to the protein's biological significance and guide experimental design for functional studies.

What strategies can address solubility and stability challenges with recombinant OsI_19898?

Researchers encountering solubility or stability issues with recombinant OsI_19898 can implement several optimization strategies:

  • Buffer optimization:

    • Test pH ranges from 6.5-8.5

    • Adjust salt concentration (150-500 mM NaCl)

    • Add stabilizers: 5-10% glycerol, 0.5-1 mM EDTA, or 1-5 mM DTT/β-mercaptoethanol

  • Expression modifications:

    • Lower induction temperature (16-18°C)

    • Reduce inducer concentration

    • Co-express with molecular chaperones

    • Use solubility-enhancing fusion tags (MBP, SUMO)

  • Protein engineering:

    • Express truncated versions to identify and remove aggregation-prone regions

    • Introduce stabilizing mutations based on homology modeling

    • Remove hydrophobic segments that may cause aggregation

  • Refolding protocols:

    • On-column refolding after denaturing purification

    • Dialysis-based refolding with decreasing denaturant concentrations

    • Flash-dilution techniques for controlled renaturation

Systematic documentation of optimization attempts provides valuable information about the protein's biophysical properties that may inform functional studies.

How can structural biology techniques be applied to elucidate OsI_19898 function?

Structural characterization of OsI_19898 can provide critical insights into its function:

Structural data can guide targeted mutagenesis experiments to validate functional hypotheses and develop structure-function relationships.

What are common challenges in working with recombinant chloroplastic proteins like OsI_19898?

Researchers should be aware of several challenges specific to chloroplastic proteins:

  • Insolubility issues: Chloroplastic proteins often contain hydrophobic regions that can lead to aggregation. Strategies to address this include:

    • Optimizing expression temperature (16-20°C)

    • Using specialized solubility-enhancing tags

    • Exploring detergent-based extraction buffers

  • Improper folding: The bacterial cytoplasm differs significantly from the chloroplast environment. Consider:

    • Co-expression with chloroplast-specific chaperones

    • Refolding protocols mimicking chloroplast pH and redox conditions

    • Expression in specialized E. coli strains with enhanced disulfide bond formation

  • Functional validation challenges: Confirming native activity requires:

    • Comparative assays with plant-derived protein

    • Reconstitution with chloroplast components

    • Functional complementation studies

  • Aggregation during storage: Prevent through:

    • Addition of stabilizing agents (glycerol, trehalose)

    • Storage at high dilution

    • Optimized buffer composition

Each challenge requires systematic troubleshooting with careful documentation to establish reliable protocols for reproducible research.

How can researchers distinguish between native functions and artifacts when characterizing OsI_19898?

To differentiate authentic functions from experimental artifacts:

  • Multiple expression systems comparison:

    • Compare properties of protein expressed in E. coli, yeast, and plant-based systems

    • Evaluate impacts of different purification tags on observed activities

  • Validation in native context:

    • Perform complementation studies in rice mutants

    • Correlate in vitro biochemical activities with in vivo phenotypes

    • Use tissue-specific or inducible expression systems for targeted analysis

  • Rigorous controls:

    • Test related proteins from the same family as specificity controls

    • Include heat-denatured protein as negative control

    • Create catalytically inactive mutants for mechanistic studies

  • Physiological relevance assessment:

    • Ensure reaction conditions reflect the chloroplastic environment (pH, ion concentrations)

    • Consider compartmentalization and local concentration effects

    • Correlate activity with conditions where the protein is naturally expressed

These approaches collectively strengthen confidence that observed activities represent native functions rather than artifacts of the recombinant system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.