Recombinant Oryza sativa subsp. indica UPF0603 protein OsI_019212, chloroplastic (OsI_19898), is a protein derived from Oryza sativa subsp. indica (rice), specifically engineered and produced using recombinant DNA technology . This protein, also known as UPF0603 protein OsI_019212, chloroplastic, is associated with the chloroplast and belongs to the UPF0603 protein family . Recombinant proteins are produced by introducing the gene encoding the protein into a host organism, such as E. coli, which then expresses the protein .
The recombinant full-length Oryza sativa subsp. indica UPF0603 protein OsI_019212, chloroplastic (OsI_19898) has the following characteristics :
| Characteristic | Description |
|---|---|
| Gene Name | OsI_19898 |
| Synonyms | OsI_19898; UPF0603 protein OsI_019212, chloroplastic |
| UniProt ID | A2Y4G9 |
| Species | Rice (Oryza sativa subsp. indica) |
| Source | E. coli |
| Tag | His (N-terminal) |
| Protein Length | Full Length of Mature Protein (99-299 amino acids) |
| AA Sequence | SEFDVLNGGPPEDTYVVDDAGVLSRVTKSDVKRLVRDLESRKNIRINFITVRKLTSKADAFEYADQVLEKWYPTVEEGNNKGIVVLVTSQKEGAITGGPAFVQAVGDEILDSTVSENLPV LATDEKYNEAIYTTAKRLAAAIDGLPDPGGPTFKDNKRESNFKTKEETEEKRGQFTLVVGGLLVIAFVVPMAQYYAYISKK |
| Purity | Greater than 90% as determined by SDS-PAGE |
| Form | Lyophilized powder |
| Storage | Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution | Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. |
The gene encoding this protein is designated as OsI_19898 . It is also known as UPF0603 protein OsI_019212, chloroplastic. The protein sequence is available under the UniProt ID A2Y4G9 .
Studies show that the native Oryza sativa cpSRP43 (OscpSRP43) is constitutively expressed in various organs of the rice plant, with the highest levels of expression found in the leaves . Subcellular localization studies using techniques such as TargetP and ChloroP indicate that OscpSRP43 is located in the chloroplast . This was confirmed through transient expression assays using rice protoplasts, where the OscpSRP43:GFP fusion protein was found to be co-localized with chlorophylls in the chloroplasts .
The function of UPF0603 protein OsI_019212, chloroplastic (OsI_19898) is not yet clearly defined. Proteins containing the UPF0603 domain are found in plants and bacteria, but their specific roles often remain uncharacterized, highlighting the need for further research to elucidate their functions.
Oryza sativa cpSRP43 (OscpSRP43) is required for normal chloroplast development and photosynthesis in rice . A rice chlorophyll-deficient mutant w67, which exhibited distinct yellow-green leaves with reduced levels of photosynthetic pigments, abnormal chloroplast development, and impaired photosynthesis compared with the wild type, was studied . The mutant phenotype was controlled by a single recessive nuclear gene, and a single base substitution in the chloroplast-targeted signal recognition particle 43 (cpSRP43) gene was responsible for the yellow-green phenotype .
Recombinant Oryza sativa subsp. indica UPF0603 protein OsI_019212, chloroplastic (OsI_19898) can be utilized in various research applications including:
ELISA assays: It can be used as an antigen in Enzyme-Linked Immunosorbent Assays (ELISA) for detecting and quantifying antibodies against this protein .
Protein interaction studies: To identify interacting partners and understand its role in protein complexes .
Structural studies: To determine the three-dimensional structure of the protein, providing insights into its function.
Functional assays: To investigate its biochemical activities and its role in chloroplast function .
STRING: 39946.BGIOSGA018092-PA
Recombinant OsI_19898 is predominantly expressed in E. coli expression systems with an N-terminal His-tag fusion to facilitate purification. The protein is expressed as a mature form (residues 99-299) without the chloroplastic transit peptide to improve solubility and yield . When designing expression constructs, researchers should consider:
| Expression Parameter | Recommended Conditions |
|---|---|
| Expression system | E. coli (BL21 or Rosetta strains) |
| Fusion tag | N-terminal His tag |
| Expression region | Mature protein (99-299) |
| Induction temperature | 16-25°C (lower temperatures improve solubility) |
| Induction time | 12-18 hours |
| Purification method | Nickel affinity chromatography |
Alternative expression systems such as insect cells may be considered for applications requiring eukaryotic post-translational modifications, though the bacterial system yields sufficient functional protein for most research applications .
For optimal stability and activity of recombinant OsI_19898, researchers should adhere to the following storage and handling protocols:
| Storage Parameter | Recommended Conditions |
|---|---|
| Long-term storage | -20°C to -80°C (prefer -80°C for extended periods) |
| Working aliquots | 4°C for up to one week |
| Storage buffer | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution buffer | Deionized sterile water |
| Recommended concentration | 0.1-1.0 mg/mL |
| Cryoprotectant | Add glycerol to 5-50% final concentration |
To minimize protein degradation: avoid repeated freeze-thaw cycles, aliquot upon receipt, and briefly centrifuge vials before opening to collect contents . For experiments requiring multiple uses, storing multiple small aliquots is strongly recommended over repeated thawing of a single stock.
To confirm the purity, identity, and integrity of recombinant OsI_19898, employ multiple complementary analytical techniques:
SDS-PAGE analysis: The protein should demonstrate >90% purity with a single predominant band at approximately 22-23 kDa plus the contribution of the His-tag .
Western blotting: Use anti-His antibodies to confirm the presence of the N-terminal His-tag and verify protein identity.
Mass spectrometry: For precise molecular weight determination and peptide mapping to confirm sequence integrity.
Size-exclusion chromatography: To assess aggregation state and homogeneity of the preparation.
Circular dichroism (CD): To evaluate secondary structure content and proper folding.
These methods collectively provide comprehensive characterization necessary for ensuring reproducible experimental results across different protein preparations .
For optimal reconstitution of lyophilized OsI_19898:
Centrifuge the vial briefly before opening to ensure all protein is collected at the bottom.
Reconstitute using deionized sterile water to a concentration of 0.1-1.0 mg/mL.
For applications where higher protein concentration is required, reconstitute in a smaller volume of buffer and determine the maximum solubility empirically.
For long-term storage of reconstituted protein, add glycerol to a final concentration of 5-50% (optimally 50%) to prevent freezing damage .
If protein precipitation occurs during reconstitution, try alternative buffers with different salt concentrations (150-500 mM NaCl) or pH values (6.5-8.5).
Reconstitution conditions may need to be optimized depending on the specific experimental application and downstream compatibility requirements.
To identify and characterize potential interaction partners of OsI_19898, researchers should employ multiple complementary techniques:
Pull-down assays: Using His-tagged recombinant protein as bait with rice chloroplast extracts, followed by mass spectrometry to identify interacting proteins.
Yeast two-hybrid (Y2H) screening: Construct bait plasmids containing the UPF0603 coding sequence to screen against rice cDNA libraries.
Surface Plasmon Resonance (SPR): Immobilize purified recombinant protein to quantitatively measure binding kinetics with potential partners.
Nucleic acid binding assays: Test for DNA/RNA binding activity using electrophoretic mobility shift assays (EMSA), as other rice proteins with similar localization have demonstrated nucleic acid binding capabilities .
Co-immunoprecipitation: Generate antibodies against the native protein for precipitation experiments with plant extracts.
When designing these experiments, it's critical to consider the native chloroplastic environment and use buffers that mimic physiological conditions to minimize artificial interactions.
Based on findings with other chloroplastic proteins in rice, OsI_19898 may have roles in stress response that can be investigated through:
Expression analysis: Quantify transcript and protein levels under various stress conditions (cold, heat, drought, salt) using qRT-PCR and Western blotting. Unlike some cold shock domain proteins that show transient upregulation of transcripts with sustained protein levels during stress , OsI_19898 may display unique expression patterns.
Transgenic approaches:
Overexpression studies: Generate transgenic rice overexpressing OsI_19898 and assess stress tolerance phenotypes
Knockdown/knockout studies: Use CRISPR-Cas9 or RNAi to reduce expression and evaluate impacts on stress susceptibility
Functional complementation: Test if OsI_19898 can complement stress-sensitive mutants in model organisms, similar to experiments with other rice proteins that complemented cold-sensitive bacterial strains .
Chloroplast function analysis: Examine photosynthetic parameters, chloroplast ultrastructure, and reactive oxygen species levels in plants with altered OsI_19898 expression under stress conditions.
The experimental design should account for potential tissue-specific responses, particularly in reproductive tissues and meristematic regions where stress-responsive proteins often accumulate .
To confirm and characterize the chloroplastic localization of OsI_19898:
Fluorescent protein fusion: Generate constructs expressing OsI_19898 fused to GFP or other fluorescent proteins to visualize localization in planta through confocal microscopy.
Immunolocalization: Develop specific antibodies against OsI_19898 for immunogold labeling and electron microscopy to determine precise sub-organellar localization.
Chloroplast fractionation: Isolate intact chloroplasts and separate thylakoid, stromal, and envelope fractions to determine where OsI_19898 predominantly associates.
Import assays: Perform in vitro chloroplast import assays to confirm the functionality of the transit peptide and processing to the mature form.
Peptide mapping: Determine the exact cleavage site of the transit peptide through N-terminal sequencing of the mature protein isolated from chloroplasts.
These approaches will provide insight into the protein's native environment and potential functional associations with specific chloroplast compartments or complexes.
Comparative genomics approaches provide valuable context for understanding OsI_19898 function:
Phylogenetic analysis: Construct phylogenetic trees of UPF0603 family proteins across plant species to identify evolutionary relationships and potential functional divergence.
Synteny analysis: Examine genomic regions surrounding OsI_19898 orthologs to identify conserved gene clusters that might indicate functional relationships.
Selective pressure analysis: Calculate Ka/Ks ratios across different plant lineages to identify regions under positive or purifying selection.
Domain architecture comparison: Analyze the conservation of protein domains and motifs across species to identify functionally important regions.
Expression pattern comparison: Compare tissue-specific and stress-responsive expression patterns of OsI_19898 orthologs across species to identify conserved regulatory mechanisms.
These analyses can reveal evolutionary constraints and adaptations that provide clues to the protein's biological significance and guide experimental design for functional studies.
Researchers encountering solubility or stability issues with recombinant OsI_19898 can implement several optimization strategies:
Buffer optimization:
Test pH ranges from 6.5-8.5
Adjust salt concentration (150-500 mM NaCl)
Add stabilizers: 5-10% glycerol, 0.5-1 mM EDTA, or 1-5 mM DTT/β-mercaptoethanol
Expression modifications:
Lower induction temperature (16-18°C)
Reduce inducer concentration
Co-express with molecular chaperones
Use solubility-enhancing fusion tags (MBP, SUMO)
Protein engineering:
Express truncated versions to identify and remove aggregation-prone regions
Introduce stabilizing mutations based on homology modeling
Remove hydrophobic segments that may cause aggregation
Refolding protocols:
On-column refolding after denaturing purification
Dialysis-based refolding with decreasing denaturant concentrations
Flash-dilution techniques for controlled renaturation
Systematic documentation of optimization attempts provides valuable information about the protein's biophysical properties that may inform functional studies.
Structural characterization of OsI_19898 can provide critical insights into its function:
Structural data can guide targeted mutagenesis experiments to validate functional hypotheses and develop structure-function relationships.
Researchers should be aware of several challenges specific to chloroplastic proteins:
Insolubility issues: Chloroplastic proteins often contain hydrophobic regions that can lead to aggregation. Strategies to address this include:
Optimizing expression temperature (16-20°C)
Using specialized solubility-enhancing tags
Exploring detergent-based extraction buffers
Improper folding: The bacterial cytoplasm differs significantly from the chloroplast environment. Consider:
Co-expression with chloroplast-specific chaperones
Refolding protocols mimicking chloroplast pH and redox conditions
Expression in specialized E. coli strains with enhanced disulfide bond formation
Functional validation challenges: Confirming native activity requires:
Comparative assays with plant-derived protein
Reconstitution with chloroplast components
Functional complementation studies
Aggregation during storage: Prevent through:
Addition of stabilizing agents (glycerol, trehalose)
Storage at high dilution
Optimized buffer composition
Each challenge requires systematic troubleshooting with careful documentation to establish reliable protocols for reproducible research.
To differentiate authentic functions from experimental artifacts:
Multiple expression systems comparison:
Compare properties of protein expressed in E. coli, yeast, and plant-based systems
Evaluate impacts of different purification tags on observed activities
Validation in native context:
Perform complementation studies in rice mutants
Correlate in vitro biochemical activities with in vivo phenotypes
Use tissue-specific or inducible expression systems for targeted analysis
Rigorous controls:
Test related proteins from the same family as specificity controls
Include heat-denatured protein as negative control
Create catalytically inactive mutants for mechanistic studies
Physiological relevance assessment:
Ensure reaction conditions reflect the chloroplastic environment (pH, ion concentrations)
Consider compartmentalization and local concentration effects
Correlate activity with conditions where the protein is naturally expressed
These approaches collectively strengthen confidence that observed activities represent native functions rather than artifacts of the recombinant system.