Recombinant Oryza sativa subsp. indica V-type proton ATPase 16 kDa proteolipid subunit (VATP-P1)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Oryza sativa subsp. indica V-type proton ATPase 16 kDa proteolipid subunit (VATP-P1) is a synthetic protein derived from the V-type ATPase (vacuolar ATPase) in rice. This enzyme complex is critical for maintaining proton gradients across cellular membranes, particularly in plant vacuoles, which regulate ion transport, pH homeostasis, and osmoregulation .

Protein Structure and Sequence

  • Length: 165 amino acids (full-length) .

  • Key Features:

    • Proteolipid Subunit: Integral membrane component of the V-ATPase complex, facilitating proton translocation .

    • Conserved Domains: High sequence homology with orthologs in Arabidopsis thaliana (99% identity), Kalanchoe daigremontiana (99%), and Oryza sativa subsp. japonica (96%) .

    • Recombinant Modifications: Expressed in E. coli with an N-terminal His-tag for purification .

Sequence Alignment Highlights

SpeciesIdentity (%)Positives (%)Score (bits)Source
Arabidopsis thaliana99100312
Kalanchoe daigremontiana99100312
O. sativa subsp. japonica9698305

Expression Systems

VATP-P1 is produced via recombinant DNA technology in E. coli, leveraging its cost-effectiveness and scalability . Key attributes:

ParameterDetailSource
HostE. coli (BL21(DE3) or DH5α strains)
TagN-terminal His-tag
Purity≥85% (SDS-PAGE validated)
Protein LengthFull-length (1–165 aa)

Role in V-ATPase Activity

As part of the V-ATPase complex, VATP-P1 contributes to:

  • Proton Pumping: Translocation of H⁺ ions across membranes to create gradients essential for nutrient uptake and organelle pH regulation .

  • Osmoregulation: Critical in plant responses to salinity and drought stress .

Experimental Utility

VATP-P1 is used in:

  • Structural Studies: Characterizing membrane protein folding and stability .

  • Functional Assays: Testing proton pump activity in vitro .

Limitations

  • Low Solubility: Inherent hydrophobicity of membrane proteins complicates crystallization and functional studies .

  • Sparse Functional Data: Limited direct evidence linking VATP-P1 to specific phenotypes in O. sativa .

Comparative Analysis with Orthologs

FeatureO. sativa subsp. indicaO. sativa subsp. japonicaAvena sativa
GenBank IDA2ZBW5LOC4349890Unavailable
HostE. coliE. coliE. coli
TagHisHisHis
Price Range$1,000–$2,000 (approx.)$1,000–$2,000 (approx.)$1,000–$2,000 (approx.)

Data aggregated from commercial catalogs .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
VATP-P1; OsI_034058; V-type proton ATPase 16 kDa proteolipid subunit; V-ATPase 16 kDa proteolipid subunit; Vacuolar proton pump 16 kDa proteolipid subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Oryza sativa subsp. indica (Rice)
Target Names
VATP-P1
Target Protein Sequence
MSSVFSGDETAPFFGFLGAASALIFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV MAGVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHLSSGLACGLAGLAAGMAIGIVGDAG VRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSRAD
Uniprot No.

Target Background

Function
Proton-conducting pore forming subunit of the membrane integral V0 complex of vacuolar ATPase. V-ATPase is responsible for acidifying various intracellular compartments in eukaryotic cells.
Database Links
Protein Families
V-ATPase proteolipid subunit family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein. Note=Tonoplast.

Q&A

What is the biological function of VATP-P1 in rice cells?

VATP-P1 serves as a proton-conducting pore-forming subunit in the V0 complex of the vacuolar (H+)-ATPase. By analogy with the human homolog, it likely participates in:

  • Acidification and pH maintenance of intracellular compartments

  • Proton translocation across membranes

  • Energy coupling between ATP hydrolysis and proton transport

In plant cells, V-type ATPases are particularly important for:

  • Vacuolar acidification

  • Stress response mechanisms

  • Cell expansion and growth

  • Nutrient storage and mobilization

The protein forms part of a multisubunit enzyme complex that includes both the V1 complex (responsible for ATP hydrolysis) and the V0 complex (responsible for proton translocation across membranes).

How should researchers properly reconstitute and store recombinant VATP-P1?

Reconstitution Protocol:

  • Centrifuge the vial briefly before opening to bring contents to the bottom

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended)

  • Aliquot for long-term storage

Storage Recommendations:

Storage ConditionPurposeNotes
-20°C/-80°CLong-term storageStore upon receipt; aliquoting necessary for multiple use
4°CWorking aliquotsStore for up to one week

Important Considerations:

  • Avoid repeated freeze-thaw cycles as they can compromise protein integrity

  • The protein is typically shipped as a lyophilized powder in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0

  • For experimental reproducibility, document storage conditions in all research protocols

What experimental approaches can be used to study VATP-P1 function in vitro?

Several methodological approaches can be employed:

  • ATPase Activity Assays:

    • Measure ATP hydrolysis rates using colorimetric phosphate detection

    • Compare activity with and without specific inhibitors (e.g., bafilomycin A1)

    • Assess pH-dependency of enzymatic activity

  • Proton Transport Assays:

    • Reconstitute protein in liposomes with pH-sensitive fluorescent dyes

    • Monitor changes in fluorescence upon ATP addition

    • Quantify proton transport rates under different conditions

  • Protein-Protein Interaction Studies:

    • Use pull-down assays with the His-tag to identify binding partners

    • Employ cross-linking approaches to capture transient interactions

    • Perform co-immunoprecipitation with antibodies against VATP-P1

  • Structural Analysis:

    • Circular dichroism to assess secondary structure

    • Limited proteolysis to identify flexible regions

    • Potentially crystallization trials for high-resolution structure determination

For all these approaches, the recombinant protein with >90% purity as determined by SDS-PAGE would be suitable .

How does the recombinant VATP-P1 compare to the native protein in terms of activity and structure?

The recombinant VATP-P1 is expressed in E. coli and contains an N-terminal His-tag, which introduces several differences compared to the native protein:

  • Post-translational modifications:

    • The recombinant protein lacks plant-specific post-translational modifications

    • This may affect certain protein-protein interactions or regulatory mechanisms

  • Solubility and folding:

    • His-tagged proteins may exhibit altered solubility properties

    • The tag can potentially interfere with proper folding in some cases

  • Activity considerations:

    • The recombinant protein is typically isolated outside its normal complex

    • Full activity may require reconstitution with other V-ATPase components

Methodological approach to assess comparability:

  • Conduct parallel activity assays with native (isolated from rice) and recombinant protein

  • Compare secondary structure using spectroscopic methods

  • Assess the impact of His-tag removal on function using proteolytic cleavage

What are the optimal conditions for integrating recombinant VATP-P1 into artificial membrane systems?

Creating functional proteoliposomes with VATP-P1 requires careful optimization:

Protocol Considerations:

  • Lipid composition:

    • A mixture of phosphatidylcholine and phosphatidylethanolamine (7:3 ratio) provides a good starting point

    • Cholesterol (10-20 mol%) can improve stability

    • Consider including plant-specific lipids like phosphatidylinositol phosphates for enhanced activity

  • Reconstitution method:

    • Detergent-mediated reconstitution using mild detergents (e.g., DDM or C12E8)

    • Gradual detergent removal via Bio-Beads or dialysis

    • Protein:lipid ratio optimization (start with 1:100 w/w)

  • Buffer conditions:

    • pH gradient formation: internal pH 7.4, external pH 6.0

    • KCl or NaCl (100-150 mM) to maintain osmotic balance

    • Mg2+ (1-5 mM) as a cofactor for the ATPase component

  • Validation approaches:

    • Freeze-fracture electron microscopy to confirm integration

    • Protease protection assays to verify orientation

    • Fluorescent probes to monitor proton pumping activity

Successful reconstitution requires iterative optimization, with each parameter systematically varied while monitoring functional outcomes.

How can researchers address potential data discrepancies when comparing VATP-P1 activity across different experimental platforms?

Data discrepancies are common when studying complex membrane proteins like VATP-P1. A methodological approach to address these includes:

  • Standardization of protein preparation:

    • Use consistent expression systems and purification protocols

    • Implement quality control checks (e.g., SDS-PAGE, circular dichroism)

    • Quantify protein concentration using multiple methods (Bradford, BCA, A280)

  • Normalization strategies:

    • Calculate specific activity (activity per mg protein)

    • Use internal controls for each experimental batch

    • Develop correction factors based on reference standards

  • Statistical analysis of variability:

    • Perform power analysis to determine appropriate sample sizes

    • Use ANOVA with post-hoc tests to identify significant differences

    • Implement mixed-effects models to account for batch variation

  • Cross-validation between methods:

    • Compare results from complementary techniques (e.g., ATPase activity vs. proton pumping)

    • Use both bulk measurements and single-molecule approaches

    • Correlate in vitro findings with cellular assays

Source of VariabilityDetection MethodMitigation Strategy
Protein puritySDS-PAGE, mass specImplement additional purification steps
Aggregation stateDynamic light scatteringOptimize buffer conditions
Lipid environmentThin layer chromatographyStandardize lipid composition
Assay interferenceControl reactionsInclude appropriate blanks and controls

By systematically addressing these factors, researchers can improve data consistency and resolve apparent contradictions in experimental results.

What are the latest approaches for studying the role of VATP-P1 in plant stress responses?

Advanced methodologies for investigating VATP-P1's role in stress responses include:

  • CRISPR-Cas9 gene editing:

    • Generate precise point mutations to study structure-function relationships

    • Create conditional knockouts using inducible promoters

    • Implement base editing for subtle modifications without double-strand breaks

  • Quantitative proteomics:

    • Use SILAC or TMT labeling to track stress-induced protein changes

    • Monitor post-translational modifications under different stress conditions

    • Employ proximity labeling (BioID, APEX) to identify stress-specific interaction partners

  • Live-cell imaging techniques:

    • Fluorescently tag VATP-P1 with minimal functional disruption

    • Employ pH-sensitive fluorescent proteins to monitor compartmental pH changes

    • Use FRET-based approaches to detect conformational changes in response to stress

  • Electrophysiological approaches:

    • Patch-clamp recordings of vacuolar membranes

    • Planar lipid bilayer reconstitution of purified components

    • Whole-cell current measurements in heterologous expression systems

These advanced techniques can reveal the dynamic regulation of VATP-P1 during environmental stresses such as drought, salinity, or pathogen attack, providing insights beyond static structural studies.

What controls should be included when conducting comparative analyses between VATP-P1 and homologs from other species?

Rigorous experimental design requires appropriate controls:

  • Negative controls:

    • Inactive mutants (e.g., mutation in the proton-binding glutamate residue)

    • Heat-denatured protein preparations

    • Reconstitution systems without protein

  • Positive controls:

    • Well-characterized homologs with established activity (e.g., human ATP6V0C)

    • Commercially available V-ATPase preparations

    • Native protein isolated from plant tissues when possible

  • Specificity controls:

    • Other membrane proteins of similar size/hydrophobicity

    • Different subunits from the V-ATPase complex

    • Proteins from unrelated proton transport systems (e.g., F-type ATPases)

  • Validation controls:

    • Complementation assays in knockout systems

    • Inhibitor sensitivity profiles

    • Antibody validation using knockout/knockdown samples

When comparing across species, it's essential to account for differences in optimal reaction conditions:

ParameterConsiderations for Cross-Species Comparison
TemperatureAdapt to physiological temperatures of each organism
pH optimaTest activity across a pH range (5.0-8.0)
Salt sensitivityVary ionic strength for each protein
Lipid requirementsInclude species-specific lipids when possible

What are the most effective approaches for studying the interaction between VATP-P1 and other components of the V-ATPase complex?

Investigating protein-protein interactions within the V-ATPase complex requires specialized techniques:

  • Co-expression systems:

    • Design multi-protein expression vectors containing various subunits

    • Implement orthogonal affinity tags for sequential purification

    • Use insect cell or yeast expression systems for complex assemblies

  • In vitro reconstitution approaches:

    • Stepwise addition of purified components with activity monitoring

    • Chemical cross-linking followed by mass spectrometry

    • Microscale thermophoresis to measure binding affinities

    • Isothermal titration calorimetry for thermodynamic parameters

  • Structural biology techniques:

    • Cryo-electron microscopy of the assembled complex

    • Hydrogen-deuterium exchange mass spectrometry to map interfaces

    • FRET-based approaches to monitor conformational changes

    • Computational modeling validated by experimental constraints

  • In vivo interaction mapping:

    • Bimolecular fluorescence complementation

    • Proximity-dependent biotin labeling (BioID, TurboID)

    • FRET/FLIM imaging in living cells

    • Co-immunoprecipitation with subunit-specific antibodies

TechniqueInformation ObtainedLimitations
Cryo-EMHigh-resolution structure of the complexRequires stable complex; challenging for dynamic interactions
Cross-linking MSIdentification of residues at interaction interfacesPotential for artificial interactions
Co-IPVerification of interactions in cellular contextMay not distinguish direct vs. indirect interactions
HDX-MSDynamics of protein interfacesLimited spatial resolution

By combining multiple complementary approaches, researchers can build a comprehensive understanding of how VATP-P1 integrates into the V-ATPase complex and contributes to its function.

How might VATP-P1 be utilized in developing stress-resistant crop varieties?

The critical role of V-type ATPases in plant stress responses makes VATP-P1 a promising target for crop improvement:

  • Genetic engineering approaches:

    • Overexpression under stress-inducible promoters

    • Introduction of specific mutations that enhance activity or stability

    • CRISPR-based promoter editing to modify expression patterns

    • Introgression of superior alleles from wild relatives

  • Phenotypic evaluation protocol:

    • Measure vacuolar pH using ratiometric fluorescent probes

    • Assess V-ATPase activity in isolated tonoplast vesicles

    • Quantify stress tolerance using standardized assays (drought, salt, cold)

    • Monitor growth parameters and yield components under stress conditions

  • Methodological considerations for translational research:

    • Test modifications in model systems before crop plants

    • Conduct field trials under diverse environmental conditions

    • Evaluate potential unintended consequences on plant development

    • Assess energy allocation trade-offs between stress resistance and yield

This research direction could lead to crops with enhanced ability to maintain cellular homeostasis under adverse conditions, potentially improving agricultural resilience to climate change.

What insights from ERP and neuroimaging studies can be applied to understand VATP-P1 function in plant cellular signaling?

While ERP (Event-Related Potential) and neuroimaging studies primarily focus on neural activity, methodological approaches from these fields can inform research on plant signaling:

  • Temporal dynamics analysis:

    • ERP studies reveal precise timing of neural responses (P1 and N1 components)

    • Similar high-temporal resolution techniques (e.g., fast fluorescence imaging) can track proton fluxes and signaling events in plant cells

    • Time-resolved analysis can distinguish between primary and secondary responses to stress

  • Spatial mapping approaches:

    • Neuroimaging localizes activity to specific brain regions

    • Analogously, subcellular localization of VATP-P1 and monitoring of compartment-specific pH changes can map proton fluxes within plant cells

    • Combined with genetically encoded sensors, this creates a comprehensive "activity map" of cellular responses

  • Integration of multiple signals:

    • Brain research combines electrophysiology, imaging, and behavior

    • Plant research can similarly integrate proton transport, calcium signaling, and transcriptional responses

    • Multi-parameter analysis reveals how VATP-P1 activity coordinates with other signaling pathways

While the biological systems differ significantly, the methodological principles of tracking spatiotemporal activity patterns can be valuable for understanding how V-ATPase function contributes to plant cellular signaling networks.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.