Recombinant Oryza sativa subsp. japonica 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 (HMG1)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Oryza sativa subsp. japonica 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 (HMG1) is an enzyme that catalyzes the synthesis of mevalonate, a precursor for all isoprenoid compounds in plants . HMG1 belongs to the HMG-CoA reductase family .

Protein Information

The HMG1 protein in Oryza sativa Japonica consists of 532 amino acids . It is a non-histone chromosomal protein high-mobility group (HMG)-1/Y (High-mobility group) of a high-mobility group that first revealed the AHL (HMG) small DNA binding protein motif .

Functional Partners

Predicted functional partners of HMG1 include :

  • 3-hydroxy-3-methylglutaryl coenzyme A synthase (A3ADI5_ORYSJ, Q64MA9_ORYSJ, Q6ZBH5_ORYSJ): This enzyme condenses acetyl-CoA with acetoacetyl-CoA to form HMG-CoA, the substrate for HMG-CoA reductase.

  • Mevalonate kinase (Q339V1_ORYSJ).

  • 1,4-dihydroxy-2-naphthoate phytyltransferase family protein (Q10QN3_ORYSJ).

  • Os03g0231800 protein (Q0DTR1_ORYSJ).

  • Squalene monooxygenase (Q10PK5_ORYSJ).

  • Os02g0107200 protein (A0A0P0VDY6).

  • Diphosphomevalonate decarboxylase (Q6ETS8_ORYSJ): Performs the first committed step in the biosynthesis of isoprene-containing compounds such as sterols and terpenoids.

  • 3-hydroxy-3-methylglutaryl-coenzyme A reductase 3 (HMG3): Catalyzes the synthesis of mevalonate.

Involvement in Plant Growth and Stress Response

HMG1, encoded by OsHMG1 (Os02g44930), is located within the QTL qTNL2-1, which is associated with the control of shoot branching under low nitrogen cultivation . The QTL qTNL2-1 also harbors genes proposed to have transcription factor binding activity, suggesting a role in regulating plant growth and development . These genes are also proposed to be involved in plant stress signaling or response mechanisms .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
HMG1; Os02g0713900; LOC_Os02g48330; 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1; HMG-CoA reductase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-532
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
HMG1
Target Protein Sequence
MDVRRGGGGGRIVGAARRALTWGALPLPMRITNGLAMVSLVLSSCDLLRLCSDRERPLGG REFATVVYLVSLFAHPDAPATTTGDDDDGQGGSRRARPAAAEPAPMHGHGGGMMEADDEE IVAAVASGALPSHRLESRLGDCRRAARLRREALRRVTGRGVEGLPFDGMDYQAILGQCCE MPVGYVQLPVGVAGPLLLDGREYHVPMATTEGCLVASVNRGCRAISASGGAFSVLLRDAM SRAPAVKLPSAMRAAELKAFAEAPANFELLAAVFNRSSRFGRLQDIRCALAGRNLYMRFS CITGDAMGMNMVSKGVENVLGYLQNVFPDMDVISVSGNYCSDKKPTAVNWIEGRGKSVVC EAIIKGDVVQKVLKTTVEKLVELNIIKNLAGSAVAGALGGFNAHASNIVTALFIATGQDP AQNVESSQCITMLEEVNDGDDLHISVTMPSIEVGTIGGGTCLASQAACLNLLGVKGSNHG SPGANAKRLATIVAGSVLAGELSLLAALASGHLVKSHMMYNRSSKDVAKAAS
Uniprot No.

Target Background

Function

Function: Catalyzes the synthesis of mevalonate, the crucial precursor for all isoprenoid compounds in plants.

Database Links

KEGG: osa:9272427

STRING: 39947.LOC_Os02g48330.1

UniGene: Os.164

Protein Families
HMG-CoA reductase family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is the function and importance of HMG1 in Oryza sativa metabolism?

HMG1 (3-hydroxy-3-methylglutaryl-coenzyme A reductase 1) catalyzes the synthesis of mevalonate, the specific precursor for all isoprenoid compounds present in plants . As a member of the HMG-CoA reductase family, it performs the rate-limiting step in the mevalonate pathway, which produces essential metabolites including sterols, terpenoids, and other isoprenoid derivatives. This 532-amino acid protein serves as a critical control point in plant secondary metabolism and influences numerous physiological processes including membrane integrity, hormone production, and defense responses . The enzyme's central position in this pathway makes it a frequent target for metabolic engineering and stress response studies in rice.

The importance of HMG1 is further highlighted by its strong interactions with other enzymes in the mevalonate pathway, forming a coordinated metabolic network essential for rice development and stress adaptation. Understanding HMG1 function provides insight into both fundamental plant metabolism and potential applications in metabolic engineering for enhanced isoprenoid production.

What protein partners interact with HMG1 and how are these interactions characterized?

HMG1 engages in multiple protein-protein interactions that are critical for coordinated metabolic function. STRING database analysis reveals several high-confidence interaction partners:

  • 3-hydroxy-3-methylglutaryl coenzyme A synthase (multiple variants including A3ADI5_ORYSJ, Q64MA9_ORYSJ, and Q6ZBH5_ORYSJ) - These enzymes condense acetyl-CoA with acetoacetyl-CoA to form HMG-CoA, which serves as the substrate for HMG-CoA reductase. These interactions show exceptionally high confidence scores ranging from 0.982-0.988 .

  • Mevalonate kinase (Q339V1_ORYSJ) - This enzyme catalyzes the phosphorylation of mevalonate produced by HMG1, with a strong interaction score of 0.942 .

  • Diphosphomevalonate decarboxylase (Q6ETS8_ORYSJ) - Performs a committed step in isoprenoid biosynthesis with an interaction score of 0.868 .

  • Squalene monooxygenase (Q10PK5_ORYSJ) - Involved in downstream sterol biosynthesis with an interaction score of 0.870 .

  • HMG3 (3-hydroxy-3-methylglutaryl-coenzyme A reductase 3) - Another isoform of the same enzyme family with a score of 0.866 .

These interactions create a functional metabolic module that ensures efficient pathway operation. Researchers typically validate these interactions through co-expression analysis using platforms like RiceFREND, co-immunoprecipitation followed by mass spectrometry, or yeast two-hybrid screening . The high interaction scores suggest tight coordination of the mevalonate pathway enzymes in rice metabolism.

How is HMG1 gene expression regulated in rice tissues and under stress conditions?

The expression analysis of HMG1 requires sophisticated methodology similar to that used for related genes in rice. While specific HMG1 expression patterns weren't detailed in the search results, the experimental approach for studying stress-responsive gene expression follows this established protocol:

  • Experimental design with contrasting genotypes (e.g., stress-tolerant vs. susceptible varieties) and multiple treatment conditions (control, drought, salt, heat) with samples collected at specific time intervals (0h, 2h, 4h) .

  • RNA isolation using specialized kits followed by quality assessment via gel electrophoresis and spectrophotometric analysis (OD260/OD280 ratio of 1.8-2.0 indicating pure RNA) .

  • cDNA synthesis using M-MuLV reverse transcriptase followed by quantitative RT-PCR with gene-specific primers designed using NCBI primer blast .

  • Data normalization using reference genes (often 18S rRNA) and relative quantification via the 2^-ΔΔCt method .

Based on patterns observed in related genes, HMG1 expression likely varies across developmental stages and responds to environmental stresses that affect isoprenoid demand. Researchers investigating HMG1 expression should maintain at least three biological replicates per condition and employ proper controls to ensure reliable results. Expression studies can be complemented with enzyme activity assays to correlate transcript levels with functional enzyme presence.

What are the optimal methods for measuring HMG1 enzyme activity?

The measurement of recombinant HMG1 enzyme activity requires precise methodology to ensure reliable results. The most established approach is the NADPH oxidation assay, which monitors the decrease in absorbance at 340 nm as NADPH is oxidized during the conversion of HMG-CoA to mevalonate . The standard reaction includes:

  • HMG-CoA substrate at varying concentrations (typically 0.15-0.6 mmol/L for kinetic studies)

  • NADPH as the essential cofactor

  • Buffer system at optimal pH (typically 7.0-7.5)

  • Purified recombinant HMG1 enzyme

For inhibition studies, potential inhibitors (such as rice bran extract fractions) can be added at defined concentrations (e.g., 0.05 mg/mL) . Enzyme activity is determined by monitoring the reaction over time under initial rate conditions, ensuring measurements remain in the linear range.

When performing kinetic analyses, researchers should obtain data at multiple substrate concentrations and analyze results using appropriate transformations such as Lineweaver-Burk plots. This allows determination of key kinetic parameters including Km and Vmax values, which under standard conditions have been reported as Km = 331.45 mM and Vmax = 1.3 mM min^-1 for HMG-CoA reductase .

For inhibition studies, the kinetic parameters are compared between control reactions and those containing inhibitors to determine both the inhibition type and strength. For example, water fraction from rice bran extract demonstrated uncompetitive inhibition, reducing both Km (to 56.57 mM) and Vmax (to 0.3 mM min^-1) .

How should researchers analyze inhibition mechanisms affecting HMG1 activity?

The analysis of inhibition mechanisms for Oryza sativa HMG1 requires systematic characterization through enzyme kinetics studies. Research with rice bran extract demonstrates an effective methodological approach:

  • First, establish baseline enzyme kinetics using varying substrate concentrations without inhibitors. For HMG-CoA reductase under standard conditions, this yields a Michaelis-Menten profile that can be transformed using a Lineweaver-Burk plot with the equation y = 257.44x + 0.7767 (R² = 0.8988), yielding Km = 331.45 mM and Vmax = 1.3 mM min^-1 .

  • Next, repeat kinetic studies with potential inhibitors at fixed concentrations. For example, with rice bran water fraction (0.05 mg/mL), the Lineweaver-Burk equation changes to y = 184.64x + 3.2641 (R² = 0.8945), with reduced Km (56.57 mM) and Vmax (0.3 mM min^-1) .

  • Determine the inhibition type by analyzing how Km and Vmax change:

    • Competitive: Increased Km, unchanged Vmax

    • Uncompetitive: Decreased Km, decreased Vmax (as observed with rice bran water fraction)

    • Non-competitive: Unchanged Km, decreased Vmax

    • Mixed: Changed Km and Vmax with complex patterns

  • Calculate inhibition constants (Ki) to quantify inhibition strength.

The observation that rice bran extract demonstrates significant inhibition (51.44%) with the water fraction showing the strongest effect (64.54%) suggests that water-soluble components from rice bran could serve as natural inhibitors of HMG1. This uncompetitive inhibition mechanism indicates that these inhibitors bind specifically to the enzyme-substrate complex rather than the free enzyme.

What techniques are recommended for expressing and purifying active recombinant HMG1?

While specific purification protocols for rice HMG1 weren't detailed in the search results, researchers should consider the following optimized approach based on related recombinant protein work:

  • Vector selection: Use pET series vectors with T7 promoter for bacterial expression, or consider pPICZ vectors for Pichia pastoris expression when post-translational modifications are important.

  • Expression system options:

    • E. coli: BL21(DE3) strain is preferred for high yields, but may require optimization for plant enzyme solubility

    • Yeast systems: Provide better folding and post-translational modifications

    • Plant expression systems: Consider when native modifications are essential

  • Expression conditions:

    • Induce at lower temperatures (16-20°C) to enhance solubility

    • Use lower IPTG concentrations (0.1-0.5 mM) for bacterial systems

    • Consider longer induction times (16-24 hours) at reduced temperatures

  • Purification strategy:

    • Include affinity tags (His6 or GST) for initial capture

    • Implement two-step purification using ion exchange chromatography as a second step

    • Consider size exclusion chromatography for final polishing

    • Include protease inhibitors throughout to prevent degradation

    • Maintain reducing conditions (DTT or β-mercaptoethanol) to preserve enzyme activity

  • Activity verification:

    • Perform NADPH oxidation assays to confirm functional enzyme

    • Compare kinetic parameters with published values (Km = 331.45 mM and Vmax = 1.3 mM min^-1)

For optimal results, purification buffers should contain glycerol (10-20%) for stability and potentially include cofactors (NADPH) at low concentrations. The high-quality recombinant enzyme should yield a single band on SDS-PAGE and demonstrate specific activity comparable to previously reported values.

How can rice bran extract components be characterized for their HMG1 inhibitory properties?

Rice bran extract shows significant inhibitory effects on HMG-CoA reductase activity, making it a valuable source of potential natural modulators. A systematic approach to characterizing these inhibitors includes:

  • Fractionation strategy: The extraction process should begin with ethanol maceration of rice bran, followed by sequential fractionation using solvents of increasing polarity :

    • n-hexane for non-polar compounds

    • Dichloromethane for moderately polar compounds

    • Ethyl acetate for more polar compounds

    • Water for highly polar compounds

  • Inhibition screening: Each fraction should be tested for HMG-CoA reductase inhibition using the NADPH oxidation assay. Findings indicate that the water fraction exhibits the strongest inhibitory effect (64.54%), compared to the original ethanol extract (51.44%) .

  • Kinetic characterization: Detailed enzyme kinetics with varying substrate concentrations in the presence of inhibitor fractions (e.g., 0.05 mg/mL) reveals the inhibition mechanism. The rice bran water fraction demonstrates uncompetitive inhibition, evidenced by:

    • Without inhibitor: Km = 331.45 mM, Vmax = 1.3 mM min^-1

    • With water fraction: Km = 56.57 mM, Vmax = 0.3 mM min^-1

  • Compound identification: The active fractions should be further analyzed using:

    • HPLC for compound separation

    • Mass spectrometry for molecular weight determination

    • NMR for structural elucidation

The uncompetitive inhibition mechanism observed suggests that the active compounds in rice bran bind specifically to the enzyme-substrate complex rather than the free enzyme. This provides valuable information for researchers developing HMG1 modulators for metabolic engineering applications.

What are the challenges in correlating in vitro HMG1 activity with in vivo isoprenoid production?

Researchers face several methodological challenges when attempting to connect in vitro enzyme activity measurements with actual isoprenoid production in rice plants:

  • Regulatory complexity: HMG1 functions within a complex metabolic network where its activity is influenced by:

    • Protein-protein interactions with pathway enzymes (HMG-CoA synthase, mevalonate kinase, etc.)

    • Potential feedback inhibition from downstream metabolites

    • Post-translational modifications affecting enzyme function

    • Transcriptional regulation under various environmental conditions

  • Compartmentalization effects: The subcellular localization of HMG1 may influence its access to substrates and interaction partners. While the mevalonate pathway operates primarily in the cytosol and endoplasmic reticulum, spatial constraints may affect in vivo activity.

  • Isoform redundancy: The presence of multiple HMG-CoA reductase isoforms (such as HMG1 and HMG3) with potentially overlapping functions complicates direct correlation studies. Gene-specific approaches are needed to differentiate their contributions.

  • Metabolic flux considerations: Static measurements of enzyme activity may not reflect dynamic metabolic flux through the pathway. Stable isotope labeling approaches with 13C-acetate can provide more accurate flux measurements.

  • Integration with systems biology: Comprehensive understanding requires integration of:

    • Transcriptomics data on gene expression under various conditions

    • Proteomics data on protein abundance and modifications

    • Metabolomics data on isoprenoid intermediate and product levels

Researchers should employ multiple complementary approaches, including both enzyme activity assays and metabolite profiling, preferably with stable isotope labeling, to establish reliable correlations between HMG1 activity and isoprenoid production in rice.

How can HMG1 be targeted for metabolic engineering applications in rice?

HMG1 represents a strategic target for metabolic engineering aimed at modifying isoprenoid production in rice. The following methodological approaches have potential for successful applications:

  • Gene expression modulation:

    • Overexpression using strong constitutive promoters (e.g., CaMV 35S) or tissue-specific promoters

    • RNAi or CRISPR-Cas9 for downregulation or knockout

    • Inducible expression systems for temporal control

    • promoter engineering to alter expression under specific conditions

  • Protein engineering strategies:

    • Site-directed mutagenesis targeting catalytic residues to alter kinetic properties

    • Removal of regulatory domains to create constitutively active variants

    • Fusion with subcellular targeting sequences to modify enzyme localization

    • Creation of synthetic protein scaffolds to enhance pathway flux

  • Pathway optimization considerations:

    • Coordinate expression with interacting partners (HMG-CoA synthase, mevalonate kinase)

    • Balance upstream substrate supply (acetyl-CoA) with downstream utilization

    • Engineer branch points to direct flux toward desired end products

    • Introduce heterologous enzymes for novel product synthesis

  • Validation and analysis methods:

    • Quantitative RT-PCR and Western blotting to confirm altered expression

    • Enzyme activity assays to verify functional changes

    • Metabolite profiling using GC-MS or LC-MS to measure pathway intermediates and products

    • Phenotypic characterization under various growth conditions

  • Potential applications:

    • Enhanced production of defensive terpenes for improved pest resistance

    • Increased sterol content for stress tolerance

    • Modified isoprenoid profiles for nutritional enhancement

    • Production of high-value specialized metabolites

The established protein-protein interaction network of HMG1 provides a valuable framework for designing coordinated engineering strategies that consider the entire mevalonate pathway rather than HMG1 in isolation.

What statistical approaches are recommended for analyzing HMG1 enzyme kinetics data?

Rigorous statistical analysis is essential for reliable interpretation of HMG1 enzyme kinetics. The following methodological framework ensures robust data analysis:

  • Experimental design considerations:

    • Include at least three technical replicates per substrate concentration

    • Perform independent biological replicates (minimum n=3)

    • Include appropriate controls (no enzyme, known inhibitors)

    • Randomize sample order to minimize systematic errors

  • Initial data processing:

    • Calculate initial reaction rates from linear portion of progress curves

    • Test for outliers using Grubbs' test or Dixon's Q test

    • Verify assumptions of normality (Shapiro-Wilk test) and equal variance (Levene's test)

  • Kinetic parameter determination:

    • Direct fitting to Michaelis-Menten equation using non-linear regression

    • For linearization approaches (Lineweaver-Burk, Eadie-Hofstee), use weighted regression

    • Report Km and Vmax with 95% confidence intervals

    • Include goodness-of-fit statistics (R² values, as shown in the rice bran inhibition study where R² = 0.8988 for the control and R² = 0.8945 for the inhibited reaction)

  • Inhibition analysis:

    • Determine inhibition type (competitive, non-competitive, uncompetitive, mixed)

    • Calculate inhibition constants (Ki) with confidence intervals

    • For complex inhibition, consider global fitting approaches

    • Report percent inhibition at defined inhibitor concentrations (e.g., 51.44% for rice bran extract, 64.54% for water fraction)

  • Presentation standards:

    • Include both graphical representations (Michaelis-Menten curves, Lineweaver-Burk plots)

    • Present results in tables with statistical parameters

    • Report equations of fitted lines (e.g., y = 257.44x + 0.7767 for control, y = 184.64x + 3.2641 for inhibited enzyme)

    • Include raw data in supplementary materials

This statistical framework ensures that enzyme kinetic parameters are determined with appropriate rigor, facilitating reliable comparisons between experimental conditions and across different studies.

How can researchers reconcile contradictory findings between in vitro and in vivo HMG1 studies?

When confronting discrepancies between in vitro enzyme characterization and in vivo observations regarding HMG1 function, researchers should implement a systematic reconciliation approach:

  • Methodological differences assessment:

    • Compare enzyme preparation methods (expression systems, purification protocols)

    • Analyze reaction conditions (buffer composition, pH, temperature, cofactor concentrations)

    • Evaluate assay methodologies (direct vs. coupled assays, detection limits)

    • Consider time scales of measurements (steady-state vs. transient kinetics)

  • Biological context considerations:

    • Isoform specificity: Determine whether studies focused on the same isoform (HMG1 vs. HMG3)

    • Compartmentalization effects: Assess subcellular localization in different studies

    • Regulatory factors: Identify potential protein-protein interactions or post-translational modifications

    • Developmental or stress context: Compare growth conditions and developmental stages

  • Integrative approaches for resolution:

    • Perform parallel in vitro and in vivo studies using identical genetic material

    • Utilize plant cell or tissue cultures as intermediate experimental systems

    • Develop mathematical models incorporating both in vitro parameters and in vivo constraints

    • Apply systems biology approaches combining transcriptomics, proteomics, and metabolomics

  • Experimental design for reconciliation:

    • Create dose-response curves for enzyme modulators in both systems

    • Use stable isotope labeling to track metabolic flux in vivo

    • Apply genetic approaches (mutants, RNAi, CRISPR) to validate enzyme function

    • Implement time-course studies to capture dynamic responses

When evaluating contradictory findings, researchers should consider that protein-protein interactions documented in the STRING database may significantly modify enzyme behavior in vivo compared to purified enzyme studies, and that the uncompetitive inhibition observed with rice bran extract might manifest differently in complex cellular environments.

What emerging technologies will advance HMG1 research in Oryza sativa?

Several cutting-edge technologies hold promise for transforming HMG1 research in rice, enabling deeper mechanistic insights and novel applications:

  • Advanced structural biology approaches:

    • Cryo-electron microscopy for high-resolution structure determination of HMG1 and its complexes

    • Hydrogen-deuterium exchange mass spectrometry to map protein dynamics and interactions

    • Single-molecule FRET to observe conformational changes during catalysis

    • AlphaFold2 and related AI-based prediction methods for structural insights

  • Genome editing and synthetic biology tools:

    • CRISPR-Cas9 base editing for precise modification of catalytic residues

    • Prime editing for introducing specific mutations without double-strand breaks

    • Synthetic promoters with tailored expression patterns

    • Optogenetic control systems for temporal regulation of HMG1 activity

  • Advanced metabolic analysis techniques:

    • MALDI-imaging mass spectrometry for spatial distribution of isoprenoids

    • Stable isotope resolved metabolomics (SIRM) using 13C-labeled precursors

    • Single-cell metabolomics to capture cell-type specific metabolic profiles

    • Fluxomics approaches using isotopically labeled precursors

  • Systems biology integration:

    • Multi-omics data integration frameworks that combine transcriptomics, proteomics, and metabolomics

    • Machine learning approaches to predict metabolic responses to environmental changes

    • Network modeling to understand HMG1's position within the broader rice metabolome

    • Digital twin approaches that simulate rice metabolism under various conditions

  • High-throughput phenotyping:

    • Automated imaging platforms for analyzing growth and development

    • Spectroscopic methods for non-destructive metabolite profiling

    • Field-deployable sensors for real-time monitoring of plant metabolism

    • Drone-based phenotyping for field trials of HMG1-modified rice

These technologies will enable researchers to move beyond the current understanding of HMG1 as a metabolic enzyme with defined interacting partners and inhibition properties , toward a comprehensive systems-level understanding of its role in rice metabolism, development, and stress responses.

What are the potential applications of HMG1 research in sustainable agriculture?

Research on rice HMG1 has significant implications for agricultural sustainability through several promising applications:

  • Stress tolerance enhancement:

    • Modulating HMG1 expression or activity could optimize isoprenoid production under stress conditions

    • Engineering HMG1 regulation may enhance membrane integrity during drought or temperature stress

    • Altered sterol profiles through HMG1 manipulation could improve tolerance to multiple abiotic stressors

    • The methodologies used to study gene expression under stress provide a framework for validating these approaches

  • Nutritional quality improvement:

    • Targeted engineering of HMG1 and related enzymes could enhance production of beneficial isoprenoids

    • Increased tocopherol (vitamin E) content through mevalonate pathway optimization

    • Enhanced carotenoid levels for improved nutritional value and stress protection

    • Biofortification strategies targeting isoprenoid-derived nutrients

  • Natural product development:

    • The inhibition properties of rice bran extracts on HMG-CoA reductase suggest potential for developing natural cholesterol-lowering supplements

    • Water-soluble components with 64.54% inhibition potential could be developed as nutraceuticals

    • Rice varieties with enhanced bioactive compound profiles could provide added health benefits

  • Pest and disease management:

    • Optimizing defensive terpene production through HMG1 modulation

    • Engineering constitutive or inducible production of pest-deterrent compounds

    • Developing rice varieties with enhanced natural resistance, reducing pesticide requirements

    • Creating trap crops with modified isoprenoid profiles to attract pests away from main crops

  • Metabolic engineering platforms:

    • Rice as a production platform for high-value isoprenoids through HMG1 engineering

    • Metabolic flux optimization using knowledge of protein interaction networks

    • Development of rice cell culture systems for bioreactor-based production of specialized metabolites

    • Creation of rice varieties as renewable sources of industrial isoprenoid compounds

The strong interaction network of HMG1 with multiple enzymes in the mevalonate pathway provides a solid foundation for these applications, as it allows for coordinated engineering approaches that optimize flux through the entire pathway rather than focusing on HMG1 in isolation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.