Recombinant Oryza sativa subsp. japonica 5'-adenylylsulfate reductase-like 4 (APRL4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
APRL4; Os08g0412401; LOC_Os08g31814; OSJNBa0007M04.15; 5'-adenylylsulfate reductase-like 4; Adenosine 5'-phosphosulfate reductase-like 4; APR-like 4; OsAPRL4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-264
Protein Length
Full Length of Mature Protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
APRL4
Target Protein Sequence
GHGVCPRQPAAAAVLPRQSSCPAAGSPGHRAHHVGVVEGDDFVLQKAVTLVLQNREDFVA ILFYASWCPFSKIFRTDFQKLSSFFPTIAHFSFEESRIKPRMLSRYGVRAFPTLFLVNST MRVRYHGSRTMNSLAMFYKDVTGMNPVSLDAISLERMEEVVNIIENDKKTEQGDSLFMFA RSPDRLLHQDTCLALASSFVLMRLLCFLLPKLNACVKQAWRMQFYELKRLLSNLS
Uniprot No.

Target Background

Database Links

UniGene: Os.15678

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the evolutionary relationship between APRL4 and other adenosine 5'-phosphosulfate reductases in rice?

APRL4 belongs to the adenosine 5'-phosphosulfate reductase (APR) family, which plays a key role in the sulfate assimilation pathway in plants. Evolutionary analyses suggest that APR-like proteins in Oryza sativa japonica evolved from a common ancestor with functionally characterized APR enzymes. The APS reductase enzymes in plants differ from their bacterial counterparts (PAPS reductases) by the presence of additional cysteine pairs in the N-terminal region, which are crucial for their unique biochemical properties . In the context of rice subspecies, japonica varieties (including temperate and tropical japonica) form a distinct evolutionary group from indica varieties, which is reflected in the genetic structure of their APR and APR-like genes .

What are the distinguishing structural features of APRL4 compared to canonical APR enzymes?

APR enzymes typically contain:

  • An N-terminal reductase domain with a conserved cysteine residue necessary for catalytic activity

  • A C-terminal thioredoxin-like domain

  • A [4Fe-4S]²⁺ cluster as a cofactor, which exhibits unusual properties as only three of the iron sites show identical Mössbauer parameters

APRL4, as an APR-like protein, shares sequence homology with canonical APRs but may differ in key features. While canonical APR enzymes contain a cysteine residue that binds sulfite in a reaction intermediate (forming a covalent C-S bond), modifications in this region in APR-like proteins may affect their catalytic mechanism . The precise structural differences that distinguish APRL4 from other APR family members are areas of ongoing research.

How can I verify the expression of recombinant APRL4 during purification?

Methodological approach for verification:

  • SDS-PAGE analysis: Run samples from each purification step on an SDS-PAGE gel to confirm the presence of your protein at the expected molecular weight.

  • Western blot: If antibodies against APRL4 or tags (His, GST, etc.) are available, perform a Western blot for specific detection.

  • Spectroscopic analysis: APR family proteins typically have a yellow-brown color due to the presence of iron-sulfur clusters. UV/visible spectrum analysis can reveal characteristic absorbance patterns indicating the presence of [4Fe-4S]²⁺ clusters .

  • Activity assay: Test for enzymatic activity using APS as a substrate and measure sulfite production, though APRL4 may have reduced or altered activity compared to canonical APRs.

  • Mass spectrometry: For definitive identification, use LC-MS/MS analysis of the purified protein to confirm identity through peptide mass fingerprinting.

What are the optimal expression conditions for recombinant APRL4 from Oryza sativa japonica?

Based on protocols established for related APR enzymes, the following conditions are recommended:

  • Expression system: E. coli BL21(DE3) or Rosetta strains are preferred due to their reduced protease activity and ability to provide rare codons that may be present in plant genes.

  • Expression vector: pET series vectors with a 6xHis tag facilitate purification via immobilized metal affinity chromatography (IMAC).

  • Growth conditions:

    • Grow cultures at 37°C until OD₆₀₀ reaches 0.6-0.8

    • Induce expression with 0.1-0.5 mM IPTG

    • Lower temperature to 18-20°C after induction

    • Continue expression for 16-20 hours to maximize properly folded protein yield

  • Media supplementation: For proper formation of iron-sulfur clusters, supplement the media with:

    • 0.1 mM FeCl₃

    • 0.1 mM Cysteine

    • 0.1 mM Methionine

  • Anaerobic conditions: Consider expression under microaerobic conditions to preserve the integrity of the iron-sulfur clusters .

What purification strategy yields the highest activity of recombinant APRL4?

A multi-step purification protocol is recommended:

  • Cell lysis: Use buffer containing:

    • 50 mM Tris-HCl (pH 8.0)

    • 300 mM NaCl

    • 10% glycerol

    • 5 mM β-mercaptoethanol or 1 mM DTT

    • Protease inhibitor cocktail

  • Initial purification: IMAC using Ni-NTA or cobalt-based resins

    • Wash with increasing imidazole concentrations (10 mM, 20 mM)

    • Elute with 250 mM imidazole

  • Secondary purification: Size exclusion chromatography

    • Use buffer containing 20 mM Tris-HCl (pH 8.0), 150 mM NaCl, 5% glycerol, and 1 mM DTT

    • This step separates aggregates and impurities based on molecular size

  • Critical considerations:

    • Perform all steps under anaerobic or microaerobic conditions when possible

    • Keep samples cold (4°C) throughout purification

    • Use freshly prepared buffers with reducing agents

    • Consider adding stabilizing agents like glycerol (10%) to preserve iron-sulfur cluster integrity

  • Activity preservation: Store purified protein in small aliquots at -80°C with 20% glycerol to maintain activity for biochemical characterization .

How do I determine if my recombinant APRL4 contains the predicted [4Fe-4S]²⁺ cluster?

Multiple complementary techniques should be employed:

  • UV-visible spectroscopy:

    • Scan purified protein between 300-700 nm

    • Look for characteristic absorbance peaks at approximately 320, 410, and 460 nm, indicative of [4Fe-4S]²⁺ clusters

    • Calculate the ratio of A₄₁₀/A₂₈₀ to estimate cluster incorporation

  • Electron paramagnetic resonance (EPR) spectroscopy:

    • [4Fe-4S]²⁺ clusters are EPR-silent (diamagnetic)

    • Reduction with dithionite can generate [4Fe-4S]¹⁺ state, which is EPR-active

    • Analyze the resulting EPR signal for characteristic features

  • Mössbauer spectroscopy:

    • Provides definitive characterization of iron-sulfur cluster type and oxidation state

    • Look for parameters similar to those reported for plant APR enzymes

    • Note that APR enzymes typically show unusual Mössbauer parameters with three iron sites exhibiting identical parameters

  • Iron and sulfide content analysis:

    • Quantify iron content using ferrozine assay or ICP-MS

    • Measure acid-labile sulfide using methylene blue assay

    • A ratio close to Fe:S = 1:1 confirms the presence of iron-sulfur clusters

What assay methods are most reliable for measuring APRL4 enzymatic activity?

Multiple complementary assays are recommended for thorough characterization:

  • Direct sulfite production assay:

    • Reaction mixture: 50 mM Tris-HCl (pH 8.0), 500 μM APS, 1-10 μg purified enzyme

    • Incubate at 25°C for 10-30 minutes

    • Quantify sulfite using fuchsin assay (spectrophotometric detection at 570 nm)

    • Control reactions without enzyme or without substrate are essential

  • Coupled enzyme assay:

    • Link sulfite production to NADPH oxidation via sulfite reductase

    • Monitor decrease in absorbance at 340 nm

    • Calculate activity using extinction coefficient of NADPH (ε = 6220 M⁻¹cm⁻¹)

  • Radioactive assay using [³⁵S]APS:

    • Incubate enzyme with [³⁵S]APS at low temperature (4°C)

    • For intermediates detection, analyze enzyme by SDS-PAGE followed by autoradiography

    • For activity, separate reaction products by HPLC and quantify radioactive sulfite formation

  • Analysis of reaction intermediates:

    • To detect the covalently bound sulfite intermediate, perform the reaction at lower temperatures (4°C)

    • Analyze tryptic peptides to identify the conserved cysteine residue with bound sulfite

    • Compare wild-type enzyme with cysteine-to-serine mutants to confirm catalytic mechanism

What is the best approach to determine kinetic parameters for APRL4?

A comprehensive kinetic analysis should include:

  • Steady-state kinetics:

    • Vary APS concentration (typically 0-500 μM)

    • Measure initial reaction rates at each substrate concentration

    • Plot data using Michaelis-Menten equation to determine Km and Vmax

    • Calculate kcat by dividing Vmax by enzyme concentration

  • Thioredoxin dependency:

    • Test activity with various thioredoxin isoforms (f, m, h, etc.)

    • Determine if the C-terminal domain of APRL4 interacts specifically with certain thioredoxin types

    • Compare activity with and without thioredoxin to determine dependency

  • pH and temperature optima:

    • Measure activity across pH range (typically 6.0-9.0)

    • Determine temperature optimum and stability (typically 20-40°C)

    • Create activity profiles to guide optimal assay conditions

  • Effect of inhibitors and activators:

    • Test sulfate as competitive inhibitor

    • Evaluate effects of metal ions (Fe²⁺, Zn²⁺, Cu²⁺)

    • Determine impact of reducing agents (DTT, GSH) on activity

How does APRL4 expression vary across different tissues and developmental stages in Oryza sativa japonica?

To comprehensively characterize expression patterns:

  • Quantitative RT-PCR analysis:

    • Design gene-specific primers for APRL4, avoiding cross-amplification with other APR family members

    • Collect RNA from different tissues (roots, leaves, stems, flowers, seeds)

    • Sample at various developmental stages

    • Normalize expression against established reference genes (e.g., actin, ubiquitin)

    • Calculate relative expression using the 2^(-ΔΔCt) method

  • Tissue-specific localization:

    • Generate promoter-reporter constructs (APRL4 promoter driving GUS or GFP)

    • Transform into rice plants

    • Analyze reporter gene expression in different tissues and cell types

    • Compare with the known distribution pattern of canonical APR enzymes, which in C4 plants are typically restricted to bundle sheath cells

  • Response to environmental conditions:

    • Test expression under sulfur deficiency/sufficiency

    • Evaluate response to various abiotic stresses (drought, salinity, heat)

    • Monitor diurnal variations in expression

    • Compare with canonical APR genes, which are known to be induced by carbohydrates and reduced nitrogen compounds

What methodologies are most effective for analyzing APRL4 genetic variation across Oryza sativa subspecies?

To assess genetic variation comprehensively:

  • Sequence analysis across subspecies:

    • Collect APRL4 sequences from various rice varieties representing the five major groups: indica, aus, aromatic, temperate japonica, and tropical japonica

    • Perform multiple sequence alignment to identify conserved and variable regions

    • Calculate nucleotide diversity (π) and polymorphism statistics

    • Apply tests for selection (Tajima's D, Ka/Ks ratio) to determine evolutionary pressures

  • Haplotype analysis:

    • Identify single nucleotide polymorphisms (SNPs) and insertion/deletion variants

    • Construct haplotype networks to visualize evolutionary relationships

    • Compare haplotype diversity between subspecies groups, considering that temperate japonica typically shows lower genetic diversity than indica or tropical japonica populations

  • Association with phenotypic traits:

    • Correlate APRL4 sequence variations with sulfur metabolism phenotypes

    • Consider performance under different environmental conditions

    • Analyze potential links to stress tolerance or nutrient use efficiency

  • Comparative genomics:

    • Analyze syntenic regions across rice subspecies and related species

    • Identify genomic structural variations affecting APRL4

    • Determine if copy number variations exist between subspecies

Table 1: Genetic diversity parameters for APR gene family across rice subspecies groups

ParameterIndicaAusTropical JaponicaTemperate JaponicaAromatic
Polymorphic loci (%)9998999188
Average alleles per locus7.265.106.094.903.40
Heterozygosity (He)0.550.540.470.390.39
Monomorphic lociLowLowLow1521

Data adapted from genetic diversity studies of rice subspecies groups

How can site-directed mutagenesis be used to elucidate the catalytic mechanism of APRL4?

Based on mechanistic studies of APR enzymes, the following approaches are recommended:

  • Target residue selection:

    • Identify conserved cysteine residue in the N-terminal domain that forms a covalent intermediate with sulfite

    • Map additional conserved residues that may participate in substrate binding or catalysis

    • Compare sequences with canonical APR to identify unique residues in APRL4

  • Mutagenesis strategy:

    • Cys → Ser substitutions to eliminate thiol groups while maintaining similar structure

    • Charge-altering substitutions (Asp → Asn, Lys → Ala) to test roles in substrate binding

    • Conservative and non-conservative substitutions to test structural vs. functional roles

  • Characterization of mutants:

    • Express and purify mutant proteins using identical conditions as wild-type

    • Compare catalytic parameters (kcat, Km) between wild-type and mutants

    • Test for formation of the sulfite-enzyme intermediate using radioactive [³⁵S]APS

    • Analyze structural integrity using circular dichroism and thermal stability assays

  • Mechanistic interpretation:

    • If the conserved cysteine mutation eliminates activity, this confirms its catalytic role

    • If activity is reduced but not eliminated, this suggests an auxiliary role

    • Correlate findings with predicted structural models and evolutionary relationships to other APR enzymes

What experimental approaches are most effective for investigating the physiological role of APRL4 in sulfur metabolism in rice?

A multi-faceted approach combining molecular genetics and biochemistry is recommended:

  • Gene knockout/knockdown strategies:

    • Generate CRISPR/Cas9 knockout lines targeting APRL4

    • Create RNAi knockdown lines for partial reduction of expression

    • Develop overexpression lines to assess gain-of-function effects

  • Phenotypic characterization:

    • Analyze growth parameters under varying sulfur availability

    • Measure key metabolites in the sulfur assimilation pathway (cysteine, glutathione)

    • Assess stress tolerance (oxidative, heavy metal, drought)

    • Monitor impact on yield components in field trials

  • Metabolic flux analysis:

    • Use ³⁵S-labeled sulfate to track sulfur assimilation rates

    • Compare flux through the pathway in wild-type vs. modified lines

    • Determine if APRL4 has high control over sulfate assimilation pathway, as canonical APR enzymes do

  • Functional complementation:

    • Test if APRL4 can rescue APR-deficient mutants in Arabidopsis

    • Determine if canonical APR can compensate for APRL4 deficiency

    • Create chimeric proteins combining domains from APRL4 and canonical APR to identify functional regions

  • Protein-protein interaction studies:

    • Identify interaction partners using yeast two-hybrid or co-immunoprecipitation

    • Test specific interactions with thioredoxin isoforms

    • Investigate potential interactions with other enzymes in the sulfur assimilation pathway

How can advanced structural biology techniques be applied to understand the unique features of APRL4?

Comprehensive structural characterization requires multiple complementary approaches:

How can I address low protein yield issues when expressing recombinant APRL4?

Systematic troubleshooting approach:

  • Expression optimization:

    • Test multiple E. coli strains (BL21, Rosetta, ArcticExpress)

    • Vary induction parameters (IPTG concentration, temperature, duration)

    • Consider codon optimization of the gene for E. coli expression

    • Test different fusion tags (His, GST, MBP) for improved solubility

  • Solubility enhancement:

    • Add solubility-enhancing additives to lysis buffer (glycerol, mild detergents)

    • Co-express with molecular chaperones (GroEL/GroES, DnaK/DnaJ)

    • Test expression at lower temperatures (16-20°C) for longer periods

    • Consider refolding from inclusion bodies if necessary

  • Iron-sulfur cluster incorporation:

    • Supplement growth media with iron and cysteine

    • Express under microaerobic conditions

    • Consider co-expression with iron-sulfur cluster assembly machinery

    • Use buffers containing DTT or β-mercaptoethanol during purification

  • Alternative expression systems:

    • If bacterial expression fails, consider yeast (Pichia pastoris)

    • For native post-translational modifications, test plant-based expression systems

What strategies can resolve inconsistent enzymatic activity measurements for APRL4?

Address variability through systematic method optimization:

  • Enzyme stability assessment:

    • Test stability at different temperatures and storage conditions

    • Determine half-life of enzymatic activity

    • Identify optimal buffer conditions for maintaining activity

    • Consider adding stabilizing agents (glycerol, BSA) to reaction buffers

  • Assay optimization:

    • Carefully control reaction temperature and pH

    • Ensure linear range for both enzyme concentration and reaction time

    • Validate assay using known APR enzymes as positive controls

    • Use multiple detection methods to cross-validate activity measurements

  • Iron-sulfur cluster integrity:

    • Monitor UV-visible spectrum before each activity assay

    • Perform assays under anaerobic conditions when possible

    • Include controls testing the impact of oxidative conditions

    • Reconstitute iron-sulfur cluster in vitro if necessary

  • Data analysis and statistical approaches:

    • Perform technical and biological replicates

    • Apply appropriate statistical tests to determine significance

    • Use robust regression methods for kinetic parameter determination

    • Consider Bayesian approaches for analyzing variable datasets

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.