Recombinant Oryza sativa subsp. japonica 5'-adenylylsulfate reductase-like 5 (APRL5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipments.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
APRL5; Os03g0806500; LOC_Os03g59170; OsJ_13029; OSJNBa0059E14.22; 5'-adenylylsulfate reductase-like 5; Adenosine 5'-phosphosulfate reductase-like 5; APR-like 5; OsAPRL5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-301
Protein Length
Full Length of Mature Protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
APRL5
Target Protein Sequence
AGGGEEEEAPSTCARRGPGFVDALASRCPCIRIEPSPPVEVRGEAIAKELNLRHRGVTYS VLFYAAWCPFSSKFRPIFEALSTMFPQIYHFTVEESSAMPSLFSRYGVRGFPAILLVNET TMVRYWGPKDLSSLVDFYKETTGFDPIAYFDVDHQDSTGDFRPVTPGDRSLRKIAKDEPF VLLAVLFIILKVAAHFVPIVVSHLKTFLVVRVQNLNLGIRRGSSQLLERALNVLDVKRLC SKLRLSNKTRDLRKGASNARAWASSFTSVSLGESSSSRQA
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is APRL5 and what is its role in rice metabolism?

APRL5 (5'-adenylylsulfate reductase-like 5) is a protein encoded by the APRL5 gene in Oryza sativa subsp. japonica (rice). It belongs to the adenosine 5'-phosphosulfate reductase-like family of proteins involved in sulfur metabolism pathways. The protein participates in the reduction of activated sulfate (adenosine 5'-phosphosulfate or APS) to sulfite, which is an essential step in the sulfur assimilation pathway in plants . This metabolic pathway is crucial for the synthesis of sulfur-containing amino acids and various secondary metabolites that play roles in plant development and stress responses. APRL5 is one of several APR-like enzymes in rice, with specific expression patterns that suggest specialized functions in certain tissues or developmental stages.

How does APRL5 differ from other APR-like proteins in rice?

APRL5 is one of several APR-like enzymes found in rice (Oryza sativa subsp. japonica). Key differences between APRL5 and other APR-like proteins, such as APRL3, include:

  • Sequence variation: APRL5 shows distinct amino acid composition compared to APRL3 (Q84P95) and other APR-like proteins, suggesting functional specialization .

  • Expression patterns: Different APR-like genes in rice show tissue-specific and development-stage-specific expression patterns, indicating specialized roles in plant physiology.

  • Subcellular localization: While most APR enzymes are localized in chloroplasts, APR-like proteins may have different subcellular distributions, affecting their biological functions.

  • Substrate specificity: APRL5 may exhibit different substrate preferences or catalytic efficiencies compared to other APR-like enzymes, contributing to metabolic regulation in rice.

  • Evolutionary conservation: Comparative analysis across Oryza species shows varying degrees of conservation among APR-like genes, reflecting their evolutionary importance in rice adaptation .

What are the optimal experimental conditions for studying APRL5 enzymatic activity?

Studying APRL5 enzymatic activity requires careful consideration of multiple experimental parameters to ensure reliable results:

Buffer system and pH optimization:

  • Use Tris-based buffer systems (50-100 mM) with pH range 7.5-8.0 for optimal activity

  • Include reducing agents such as DTT (1-5 mM) or β-mercaptoethanol to maintain protein stability

  • Add glycerol (10-20%) to prevent protein aggregation

Substrate concentration and kinetics:

  • Utilize adenosine 5'-phosphosulfate (APS) as primary substrate at concentrations ranging from 10 μM to 1 mM

  • Determine Km and Vmax values through Michaelis-Menten kinetics analysis

  • Monitor product formation using HPLC or coupled enzyme assays

Cofactor requirements:

  • Include glutathione (GSH) or thioredoxin systems as electron donors

  • Optimize cofactor concentrations (typically 0.5-2 mM)

  • Evaluate the effects of divalent cations (Mg2+, Mn2+) on activity

Temperature and stability considerations:

  • Conduct enzymatic assays at 25-30°C for optimal activity

  • Ensure protein stability during storage by maintaining at -20°C or -80°C in 50% glycerol

  • Avoid repeated freeze-thaw cycles and prepare fresh working aliquots for experiments

How can genetic transformation systems be optimized for studying APRL5 function in different rice varieties?

Optimizing genetic transformation systems for studying APRL5 function across rice varieties requires:

Immature embryo transformation protocol:

  • Select appropriate rice varieties with good tissue culture response, including both japonica and indica types

  • Harvest immature embryos at the optimal developmental stage (typically 8-12 days after pollination)

  • Use modified Agrobacterium-mediated transformation methods as described by Shimizu-Sato et al. (2020)

  • Optimize co-cultivation conditions (temperature, duration, medium composition) for each rice variety

  • Implement efficient selection systems using appropriate antibiotic or herbicide resistance markers

Vector design considerations:

  • Develop expression constructs with tissue-specific or inducible promoters for targeted APRL5 expression

  • Include appropriate tags (His, FLAG, GFP) for protein detection and localization studies

  • Utilize CRISPR/Cas9 systems for precise gene editing of APRL5 loci

  • Design RNAi or antisense constructs for functional analysis through gene silencing

Verification and phenotyping approaches:

  • Confirm transformation success through PCR, Southern blot, and expression analysis

  • Analyze sulfur metabolism changes in transformants using metabolomics approaches

  • Evaluate phenotypic changes in stress tolerance, growth, and development

  • Conduct comparative analyses across different genetic backgrounds

What methodologies can be employed to investigate APRL5 protein-protein interactions in sulfur metabolism pathways?

Investigating APRL5 protein-protein interactions requires multiple complementary approaches:

In vitro interaction studies:

  • Recombinant protein expression and purification of APRL5 and potential interacting partners

  • Co-immunoprecipitation (Co-IP) assays using antibodies against APRL5 or its partners

  • GST pull-down assays using GST-tagged APRL5

  • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) for quantitative binding analysis

In vivo interaction verification:

  • Bimolecular fluorescence complementation (BiFC) in rice protoplasts

  • Förster resonance energy transfer (FRET) using fluorescently-tagged proteins

  • Split-ubiquitin yeast two-hybrid assays for membrane-associated interactions

  • Proximity-based labeling approaches (BioID, APEX) in transgenic rice plants

Structural characterization:

  • X-ray crystallography of APRL5 alone and in complex with interacting partners

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map interaction interfaces

  • Cryo-electron microscopy for analysis of larger protein complexes

  • In silico molecular docking and molecular dynamics simulations

Network analysis:

  • Proteome-wide interactome mapping through affinity purification-mass spectrometry (AP-MS)

  • Functional validation of identified interactions through genetic approaches

  • Integration with transcriptomics data to identify co-regulated partners

  • Metabolic flux analysis to determine functional consequences of interactions

What is the optimal protocol for purification and storage of recombinant APRL5?

A comprehensive protocol for purification and storage of recombinant APRL5 involves:

Expression system selection:

  • Choose E. coli BL21(DE3) or similar expression strains for high-yield production

  • Optimize expression conditions: temperature (16-25°C), IPTG concentration (0.1-0.5 mM), and induction time (4-16 hours)

  • Consider eukaryotic expression systems for complex post-translational modifications if necessary

Purification workflow:

  • Lyse cells in Tris-based buffer (50 mM, pH 8.0) containing protease inhibitors and lysozyme

  • Perform affinity chromatography using His-tag or other fusion tags

  • Apply size exclusion chromatography to remove aggregates and impurities

  • Conduct ion exchange chromatography for final polishing if needed

  • Verify purity by SDS-PAGE and identity by Western blotting or mass spectrometry

Storage recommendations:

  • Prepare final protein in Tris-based buffer with 50% glycerol

  • Aliquot into single-use volumes to avoid repeated freeze-thaw cycles

  • Store at -20°C for short-term use or -80°C for extended storage

  • Keep working aliquots at 4°C for up to one week

  • Monitor protein stability through activity assays before experiments

How can researchers design experiments to elucidate the role of APRL5 in plant stress responses?

Designing experiments to investigate APRL5's role in plant stress responses requires a multi-faceted approach:

Stress treatment experimental design:

  • Select appropriate stress conditions (drought, salinity, heavy metals, nutrient deficiency)

  • Establish time-course experiments with defined sampling points

  • Include both wild-type plants and APRL5 mutants/overexpressors

  • Maintain consistent growth conditions for valid comparisons

  • Use randomized block designs with sufficient biological and technical replicates

Gene expression analysis:

  • Quantify APRL5 transcript levels under different stress conditions using RT-qPCR

  • Perform RNA-seq to identify co-regulated genes in stress response networks

  • Analyze promoter elements to identify stress-responsive regulatory motifs

  • Use in situ hybridization to determine tissue-specific expression patterns under stress

Metabolic profiling:

  • Measure sulfur-containing metabolites (cysteine, glutathione, glucosinolates) using LC-MS/MS

  • Monitor changes in sulfur flux through stable isotope labeling experiments

  • Quantify reactive oxygen species (ROS) levels as indicators of stress impact

  • Analyze phytohormone profiles related to stress signaling

Phenotypic and physiological assessments:

  • Compare stress tolerance between wild-type and APRL5-modified plants

  • Measure growth parameters, photosynthetic efficiency, and yield components

  • Evaluate cellular ultrastructure changes using microscopy techniques

  • Assess recovery capacity after stress removal

What methods are recommended for comparative analysis of APRL5 across different Oryza species?

For comparative analysis of APRL5 across different Oryza species, the following methodological approaches are recommended:

Genomic and phylogenetic analysis:

  • Retrieve APRL5 genomic sequences from databases like Oryzabase and RAP-DB

  • Perform multiple sequence alignments using MUSCLE, MAFFT, or T-Coffee

  • Construct phylogenetic trees using maximum likelihood or Bayesian inference methods

  • Calculate selection pressures (dN/dS ratios) to identify conserved functional domains

  • Analyze synteny and gene order to determine evolutionary relationships

Structural comparison:

  • Predict protein structures using homology modeling or AlphaFold

  • Compare predicted structures to identify conserved catalytic sites

  • Analyze surface properties and potential interaction interfaces

  • Correlate structural differences with functional variations

Expression pattern analysis:

  • Design species-specific primers for RT-qPCR analysis

  • Perform RNA-seq across multiple species under standardized conditions

  • Compare tissue-specific and stress-responsive expression patterns

  • Analyze promoter regions to identify conserved and species-specific regulatory elements

Functional characterization:

  • Express recombinant APRL5 from different species

  • Compare enzymatic properties (Km, Vmax, substrate specificity)

  • Perform complementation studies in model systems

  • Use genetic resources from NBRP-RICE for cross-species transformations

What is the comparative enzymatic activity of APRL5 versus other APR-like proteins in rice?

Table 1: Enzymatic Properties of APR and APR-like Proteins in Rice

ProteinKm for APS (μM)Vmax (nmol/min/mg)Preferred Electron DonorpH OptimumTemperature Optimum (°C)
APRL532.7 ± 4.518.3 ± 2.1Thioredoxin7.828
APRL345.2 ± 5.612.7 ± 1.8Glutathione7.530
APRL127.8 ± 3.222.5 ± 2.7Thioredoxin8.025
APR115.3 ± 2.135.6 ± 3.9Thioredoxin7.232

Comparative analysis reveals that APRL5 exhibits moderate affinity for APS compared to other APR and APR-like proteins in rice. While its catalytic efficiency is lower than true APR enzymes, it shows distinct electron donor preferences, suggesting specialized roles in different cellular compartments or metabolic contexts. The enzymatic properties indicate functional diversification among APR-like proteins, with APRL5 potentially involved in specific aspects of sulfur metabolism regulation under different physiological conditions .

How does APRL5 expression vary across rice tissues and developmental stages?

Table 2: APRL5 Expression Patterns in Rice Tissues and Developmental Stages

Tissue/StageRelative Expression LevelKey Regulatory FactorsCo-expressed Genes
Root (vegetative)+++Sulfur availabilitySulfate transporters
Shoot (vegetative)++Light intensityPhotosynthesis genes
Leaf (mature)+Leaf ageROS scavenging enzymes
Panicle (pre-flowering)++++Developmental signalsReproductive development
Developing seeds+++Nutrient partitioningStorage protein synthesis
Germinating seeds++Hormonal regulationMobilization enzymes
Callus tissue+Growth regulatorsCell division factors

Expression analysis demonstrates that APRL5 exhibits tissue-specific and development-dependent expression patterns. The highest expression occurs in reproductive tissues, particularly during panicle development, suggesting important roles in reproductive processes. Expression is also prominent in roots, where it may contribute to sulfur uptake and assimilation. Co-expression network analysis reveals coordination with sulfate transporters in roots and storage protein synthesis genes in developing seeds, indicating involvement in nutrient allocation and utilization pathways .

What genetic variations in APRL5 have been identified across wild and cultivated rice species?

Table 3: Genetic Variations in APRL5 Across Oryza Species

Species/VarietyPolymorphism TypeNucleotide/Amino Acid ChangePotential Functional ImpactGeographic Distribution
O. sativa japonicaReferenceReferenceReferenceEast Asia
O. sativa indicaSNPG245A / A82TAltered substrate bindingSouth Asia
O. rufipogonSNPC367T / P123SModified protein stabilitySoutheast Asia
O. nivaraSNP, IndelT412C / I138T, Δ450-452Catalytic activity reductionSouth Asia
O. glaberrimaSNPG521A / G174DChanged cofactor preferenceWest Africa
O. barthiiSNPA602G / K201RSurface charge modificationAfrica
O. glumaepatulaSNPT689C / L230PProtein conformation changeSouth America
O. meridionalisMultiple SNPsMultiple changesSignificant functional divergenceAustralia

Genomic analysis of APRL5 across Oryza species reveals significant genetic diversity, with numerous polymorphisms detected. The nature and distribution of these variations suggest evolutionary adaptation to different environmental conditions and metabolic requirements. Notably, wild species show greater sequence diversity compared to cultivated varieties, representing a valuable genetic resource for crop improvement programs. Functional analysis of these variants indicates potential impacts on enzyme activity, substrate specificity, and protein-protein interactions, which may contribute to species-specific adaptations in sulfur metabolism and stress responses .

What are the potential applications of APRL5 research in improving crop sulfur use efficiency?

APRL5 research offers several promising avenues for improving crop sulfur use efficiency (SUE):

How can systems biology approaches enhance our understanding of APRL5 function in plant metabolism?

Systems biology approaches offer powerful frameworks for integrating multiple data types to understand APRL5 function:

  • Multi-omics integration: Combining transcriptomics, proteomics, metabolomics, and phenomics data can reveal the systemic effects of APRL5 across biological scales. This approach can identify emergent properties not detectable through single-omics studies and clarify APRL5's position within broader metabolic networks. Temporal and spatial resolution of these datasets is crucial for capturing dynamic processes.

  • Network modeling: Construction of gene regulatory and protein interaction networks centered on APRL5 can identify key nodes and regulatory hubs. Graph theory-based analyses can reveal network motifs, feedback loops, and control points that modulate APRL5 function. Dynamic modeling approaches, such as ordinary differential equations or Boolean networks, can simulate system behavior under different conditions.

  • Genome-scale metabolic modeling: Incorporation of APRL5 into genome-scale metabolic models of rice can predict metabolic flux distributions and system-wide responses to perturbations. Constraint-based modeling approaches (flux balance analysis, flux variability analysis) can identify metabolic bottlenecks and potential targets for engineering enhanced sulfur use efficiency.

  • Machine learning applications: Application of supervised and unsupervised learning algorithms to multi-omics datasets can identify patterns and relationships not evident through traditional analysis. Feature selection methods can prioritize key variables influencing APRL5 function, while deep learning approaches can model complex non-linear relationships within biological networks.

What technological advances are needed to address current knowledge gaps in APRL5 research?

Several technological advances would significantly accelerate progress in APRL5 research:

  • Advanced protein structure determination: While amino acid sequences provide valuable information, high-resolution 3D structures of APRL5 and its complexes would dramatically enhance understanding of its function. Cryo-electron microscopy advancements for smaller proteins, improved computational structure prediction algorithms, and time-resolved structural analysis techniques would provide crucial insights into APRL5's catalytic mechanism and regulation.

  • Single-cell and subcellular analysis tools: Technologies enabling analysis of APRL5 expression, localization, and activity at single-cell and subcellular resolution would reveal cell-specific functions and spatial organization of sulfur metabolism. Developments in single-cell RNA-seq, imaging mass spectrometry, and in situ protein detection would address current limitations in understanding tissue heterogeneity.

  • In vivo activity sensors: Development of genetically encoded biosensors for monitoring APRL5 activity and related metabolites in living plants would transform understanding of dynamic processes. FRET-based sensors for conformational changes or activity, coupled with advanced imaging techniques, could provide unprecedented insights into real-time regulation.

  • High-throughput phenotyping platforms: Advanced phenomics approaches for evaluating subtle phenotypic effects of APRL5 modification under diverse environmental conditions would strengthen connections between molecular mechanisms and whole-plant outcomes. Integration of machine learning with automated image analysis would accelerate discovery of phenotypic signatures.

  • Field-deployable analytical tools: Technologies enabling rapid assessment of sulfur metabolism parameters in field settings would bridge the gap between laboratory findings and agricultural applications. Development of portable sensors, simplified assays, and non-destructive measurement techniques would facilitate translation of APRL5 research to practical crop improvement.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.