Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
APRL6; Os12g0541600; LOC_Os12g35640; 5'-adenylylsulfate reductase-like 6; Adenosine 5'-phosphosulfate reductase-like 6; APR-like 6; OsAPRL6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Protein Length
Full Length of Mature Protein
Species
Oryza sativa subsp. japonica (Rice)
Target Protein Sequence
AEPEEARCPRERLPPFVAAAAAAALRPSCRASAERCPAEEINGEELVKELSGKEECTAVL
FYASWCPFSQRMRPVFDDLSSMFPRIKHLAVEQTNAMPAVLSRYGVRSFPSILIACGPYA
YWPVGSKELDSLVNVYTAVTGQEPIAYLGPRKWSAARTGSTQHVKLWKSSIIEALKSEPY
LAFSILFICLKILVAFFPKFFSCIKGIWVQYFRHANLGILAKLTQLLECVPHAVDLRKIW
SKCRLMGGAMNSRVWASSLASMSFGERSSPRAAVLD