Recombinant Oryza sativa subsp. japonica ADP,ATP carrier protein, mitochondrial (Os02g0718900, LOC_Os02g48720)

Shipped with Ice Packs
In Stock

Description

Functional Role in Mitochondrial Energy Metabolism

This carrier belongs to the mitochondrial carrier family (MCF) and facilitates the exchange of ATP and ADP across the inner mitochondrial membrane. Key functions include:

  • ADP/ATP transport: Exchanges cytoplasmic ADP for mitochondrial ATP, enabling oxidative phosphorylation and cytosolic energy supply .

  • State-dependent transport: Operates via conformational cycling between cytoplasmic-open (ADP-binding) and matrix-open (ATP-binding) states, driven by substrate concentration gradients and membrane potential .

Table 2. Transport Mechanism

ProcessDescriptionSource
Substrate SpecificityBinds deprotonated ADP/ATP (no Mg²⁺/Ca²⁺)
DirectionalityGoverned by substrate gradients and membrane potential
Auxiliary FunctionPotential H⁺ transport (inferred from homologous mammalian AACs)

While direct evidence for H⁺ transport in the rice protein is lacking, homologous mammalian ADP/ATP carriers exhibit proton leak activity, regulated by fatty acids and nucleotide exchange rates .

Recombinant Expression and Research Applications

The recombinant protein is produced in E. coli and purified for biochemical studies. Applications include:

  • ELISA assays: Used to quantify ADP/ATP carrier abundance in rice tissues .

  • Transport assays: Studied in E. coli and mitochondrial membrane preparations to analyze nucleotide exchange kinetics .

  • Structural studies: Serves as a model for understanding MCF transport mechanisms, including conformational changes and substrate binding .

Key Research Findings

Significance in Plant Metabolism and Research

This carrier is essential for rice mitochondrial function, particularly in energy-intensive processes like photosynthesis and respiration. Its recombinant form enables:

  • Functional characterization: Elucidating transport mechanisms in non-mammalian systems.

  • Comparative studies: Mapping evolutionary conservation of ADP/ATP transport across eukaryotes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your preparation.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If a particular tag is required, please specify this in your order for preferential development.
Synonyms
Os02g0718900; LOC_Os02g48720; OJ2056_H01.33; ADP,ATP carrier protein, mitochondrial; ADP/ATP translocase; Adenine nucleotide translocator; ANT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
72-382
Protein Length
Full Length of Mature Protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os02g0718900
Target Protein Sequence
NAPAEKGGKNFMIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGD CFGRTIKDEGFASLWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDKDGYWKWFGGNL ASGGAAGASSLFFVYSLDYARTRLANDAKAAKGGGERQFNGLVDVYRKTLKSDGIAGLYR GFNISCVGIIVYRGLYFGMYDSLKPVVLTGSLQDNFFASFALGWLITNGAGLASYPIDTV RRRMMMTSGEAVKYKSSMDAFSQILKNEGAKSLFKGAGANILRAIAGAGVLSGYDQLQIL FFGKKYGSGGA
Uniprot No.

Target Background

Function

This recombinant Oryza sativa subsp. japonica ADP/ATP carrier protein (Os02g0718900, LOC_Os02g48720), a mitochondrial protein, functions as an ADP/ATP antiporter. It facilitates the import of ADP into the mitochondrial matrix for ATP synthesis and the export of ATP to provide cellular energy. This protein utilizes an alternating access mechanism with a single substrate-binding site that sequentially exposes itself to either the cytosolic or matrix side of the inner mitochondrial membrane, cycling between cytoplasmic-open (c-state) and matrix-open (m-state) conformations.

Database Links

KEGG: osa:4330539

STRING: 39947.LOC_Os02g48720.1

UniGene: Os.9282

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the official nomenclature and classification of the rice ADP/ATP carrier protein?

The Oryza sativa ADP/ATP carrier protein is officially classified under the following nomenclature:

  • CGSNL Gene Symbol: ANT

  • Gene Symbol Synonyms: ant, ricANC1, ANC1

  • CGSNL Gene Name: ADENOSINE NUCLEOTIDE TRANSLOCATOR

  • Gene Name Synonyms: adenine nucleotide translocator, "ADP,ATP carrier protein, mitochondrial precursor", "ADP,ATP carrier protein, mitochondrial", ADP/ATP translocase, ATP/ADP translocator

  • Protein Name: ADENOSINE NUCLEOTIDE TRANSLOCATOR

  • Chromosome No.: 2

  • LOC ID: LOC_Os02g48720.1, LOC_Os02g48720.2

  • RAP ID: Os02g0718900

This protein belongs to the Mitochondrial Carrier Family (MCF) of transport proteins, which facilitate the transport of metabolites across the inner mitochondrial membrane.

What is the biological function of the ADP/ATP carrier protein in rice?

The rice ADP/ATP carrier protein functions as a crucial transporter that exchanges ADP and ATP across the mitochondrial inner membrane. It imports ADP from the cytoplasm into the mitochondrial matrix, where ATP synthesis occurs via oxidative phosphorylation, and exports the newly synthesized ATP to the cytoplasm to fuel cellular processes .

The protein cycles between two conformational states:

  • Cytoplasmic-open state: oriented to receive ADP from the cytoplasm

  • Matrix-open state: oriented to release ADP into the matrix and collect ATP for export

In rice, as in other plants, this exchange is essential for energy metabolism, particularly during developmental processes and stress responses. Gene ontology classifications indicate that this protein is involved in:

  • Transporter activity (GO:0005215)

  • Binding (GO:0005488)

  • Transport (GO:0006810)

  • Adenine nucleotide transmembrane transporter activity (GO:0000295)

  • Localized to the mitochondrial inner membrane (GO:0005743)

How is the expression of rice ADP/ATP carrier protein regulated during development and stress conditions?

The expression of the rice ADP/ATP carrier protein shows developmental and stress-responsive regulation patterns. While specific expression data for rice Os02g0718900 is limited in the provided search results, we can infer regulatory patterns based on research in related plants:

During fruit development in tomato, nucleotide transporters including ADP/ATP carriers show stage-specific expression patterns. For instance, comparable proteins show differential expression at specific stages like pink (P) and green (G) stages of fruit development .

In stress conditions, particularly those affecting mitochondrial function, expression of ADP/ATP carriers may be modulated as part of cellular adaptive responses. This is evidenced by research on stress responses in rice, where ethylene signaling (which often increases during stress) influences mitochondrial function and energy metabolism .

Research investigating the role of light on ethylene metabolism has shown that transcription factors like PIF3-LIKE 1 (PIL-1) and ARABIDOPSIS THALIANA HOMEOBOX PROTEIN 2 (ATHB2) can influence expression of genes involved in hormone biosynthesis and energy metabolism pathways .

What structural conformations does the rice ADP/ATP carrier adopt during the transport cycle?

The rice ADP/ATP carrier protein, like other mitochondrial ADP/ATP carriers, cycles between two main conformational states during transport:

  • Cytoplasmic-open state: In this conformation, the carrier has a binding site accessible from the intermembrane space (cytoplasmic side). This state is primed to bind ADP from the cytoplasm for import into the mitochondria. The structure of this state has been well-characterized in several species .

  • Matrix-open state: Following a conformational change, the carrier opens toward the matrix side of the mitochondrial inner membrane. This state facilitates the release of ADP into the matrix and the binding of ATP for export to the cytoplasm. This state has been more difficult to characterize structurally, though recent research has made progress in describing it .

The transition between these states involves substantial conformational changes that alternative between exposing the substrate binding site to either side of the membrane. This "alternating access mechanism" is characteristic of carrier proteins and involves the movement of transmembrane domains.

Recent structural studies suggest that the matrix-open state can be stabilized by specific inhibitors or binding partners, allowing for crystallographic or cryo-EM studies. This has advanced our understanding of the complete transport cycle .

How does the transport kinetics of the rice ADP/ATP carrier compare to homologous carriers in other species?

While specific kinetic data for the rice ADP/ATP carrier (Os02g0718900) is not detailed in the provided search results, comparative analysis with homologous carriers provides valuable insights:

In Trypanosoma brucei, the ADP/ATP carrier TbMCP5 demonstrates kinetic properties similar to the well-characterized ScAnc2p carrier from yeast (Saccharomyces cerevisiae). Experimental analysis of TbMCP5 revealed comparable biochemical ADP/ATP transport kinetics to the yeast carrier .

For context, typical kinetic parameters for mitochondrial ADP/ATP carriers include:

SpeciesCarrierKm for ADP (μM)Km for ATP (μM)Transport Rate (μmol/min/mg)
YeastScAnc2p5-2010-30400-1200
T. bruceiTbMCP5Similar to yeastSimilar to yeastComparable to yeast
RiceOs02g0718900Not specifically determined in provided dataNot specifically determined in provided dataNot specifically determined in provided data

Given the conserved nature of these carriers across eukaryotes, we would expect the rice ADP/ATP carrier to exhibit kinetic parameters in similar ranges, though specific environmental adaptations may introduce variations in substrate affinity or transport rates.

What is the impact of phosphate carrier interaction with the ADP/ATP carrier on mitochondrial energy metabolism in rice?

The interaction between phosphate carriers and ADP/ATP carriers is critical for maintaining proper mitochondrial energy metabolism. While detailed information specific to rice is limited in the provided search results, functional studies in other organisms provide a framework for understanding these interactions:

Research in Trypanosoma brucei has shown that phosphate carriers (e.g., TbMCP11) can be essential for survival in certain developmental stages, highlighting their crucial role in energy metabolism . In the procyclic form of T. brucei, silencing of the phosphate carrier TbMCP11 resulted in a lethal growth phenotype, whereas silencing in the bloodstream form had no effect .

For efficient ATP synthesis in mitochondria, a coordinated transport system involving both ADP/ATP carriers and phosphate carriers is essential:

  • The ADP/ATP carrier imports ADP into the mitochondrial matrix

  • The phosphate carrier imports inorganic phosphate needed for ATP synthesis

  • ATP synthase uses the imported ADP and phosphate, along with the proton gradient, to generate ATP

  • The newly synthesized ATP is exported back to the cytoplasm via the ADP/ATP carrier

Disruption of either transport system can significantly impact mitochondrial energy production and cellular metabolism. In rice, given its adaptability to various environmental conditions (including oxygen-limited environments like flooded paddies), this coordination may have specialized regulatory mechanisms.

What expression systems are most effective for producing recombinant rice ADP/ATP carrier protein for structural studies?

For successful production of recombinant rice ADP/ATP carrier protein (Os02g0718900), researchers should consider the following expression systems and methodological approaches:

Heterologous Expression Systems:

  • Yeast Expression System (S. cerevisiae or P. pastoris):

    • Advantages: Eukaryotic system with appropriate post-translational modifications and membrane insertion machinery

    • Method: Replace the endogenous ADP/ATP carrier gene with the rice carrier gene using homologous recombination

    • Example: Studies have successfully used yeast systems to express and characterize mitochondrial carriers, including phosphate carriers like TbMCP11

  • E. coli Expression System:

    • Advantages: High yield, simplicity, cost-effectiveness

    • Method: Use specialized strains optimized for membrane protein expression (C41, C43, or Lemo21)

    • Considerations: May require fusion partners (MBP, SUMO) to improve solubility and proper folding

  • Insect Cell Expression (Baculovirus):

    • Advantages: Higher eukaryotic system, good for complex membrane proteins

    • Method: Bacmid-based expression in Sf9 or Hi5 cells

Purification Strategy:

  • Solubilization using mild detergents (DDM, LMNG, or GDN)

  • Immobilized metal affinity chromatography (IMAC) using His-tag

  • Size exclusion chromatography for final purification

  • Consider nanodiscs or amphipols for improved stability

Stability Assessment:
Monitor protein stability using methods such as thermal shift assays or limited proteolysis to optimize buffer conditions.

For structural studies specifically, researchers have successfully determined the structure of ADP/ATP carriers in different conformational states by using specific inhibitors to lock the protein in either the cytoplasmic-open or matrix-open state .

What methods can be used to accurately measure transport activity of the rice ADP/ATP carrier protein?

Several complementary methods can be employed to measure the transport activity of the rice ADP/ATP carrier protein:

1. Reconstitution into Liposomes:

  • Purify the recombinant carrier and reconstitute into liposomes

  • Load liposomes with either ADP or ATP

  • Initiate transport by adding the counter-substrate externally

  • Measure substrate exchange using:

    • Radiolabeled substrates ([14C] or [3H]-labeled ATP/ADP)

    • Fluorescent ATP/ADP analogs with spectrofluorometric detection

    • Luciferase-based ATP detection systems

2. Mitochondrial Transport Experiments:

  • Isolate mitochondria from expressing cells (yeast or insect cells)

  • Measure ADP/ATP exchange using:

    • Oxygen consumption rates (respirometry)

    • Membrane potential monitoring (with fluorescent dyes like TMRM)

    • Direct measurement of nucleotide transport with labeled substrates

3. Patch-Clamp Electrophysiology:

  • For detailed biophysical characterization of transport kinetics

  • Can measure individual transport events and determine:

    • Transport rates

    • Voltage dependence

    • Effects of inhibitors

4. Yeast Complementation Assays:
Similar to studies with TbMCP5 and TbMCP11 , functional complementation in carrier-deficient yeast strains provides a powerful tool to assess in vivo transport activity:

  • Express rice ADP/ATP carrier in yeast strains lacking endogenous carriers

  • Assess growth restoration on non-fermentable carbon sources (requiring mitochondrial ATP production)

  • Compare growth rates to quantify transport efficiency

5. Isothermal Titration Calorimetry (ITC):

  • Determine binding affinities for ADP and ATP

  • Characterize the thermodynamics of substrate binding

These methods provide complementary data on transport activity, substrate specificity, and kinetic parameters of the rice ADP/ATP carrier protein.

What CRISPR/Cas9 strategies are most effective for investigating the function of the rice ADP/ATP carrier protein in vivo?

For investigating the function of the rice ADP/ATP carrier protein (Os02g0718900) in vivo using CRISPR/Cas9, researchers should consider the following strategic approaches:

1. Guide RNA Design and Selection:

  • Target exonic regions of the ANT gene (Os02g0718900)

  • Design multiple gRNAs (3-4) targeting different exons to improve editing efficiency

  • Use rice-optimized CRISPR/Cas9 systems with appropriate promoters (e.g., OsU3 or OsU6 for gRNA expression)

  • Employ software tools specific for rice genome editing (e.g., CRISPR-P 2.0, CRISPR-GE) to identify optimal target sites with minimal off-target effects

2. Editing Strategies Based on Research Questions:

A. Complete Gene Knockout:

  • For examining essentiality and severe phenotypes

  • May require inducible systems if the carrier is essential (as suggested by studies in other organisms )

  • Design gRNAs targeting early exons to create frameshift mutations

B. Domain-Specific Modifications:

  • For structure-function studies

  • Target regions encoding specific transmembrane domains or the substrate binding site

  • Create precise amino acid substitutions using HDR (homology-directed repair) with donor templates

C. Promoter Editing:

  • For studying expression regulation

  • Target the promoter region to alter expression levels

  • Create reporter fusions to monitor expression patterns

3. Transformation Methods:

  • Agrobacterium-mediated transformation of rice calli

  • Protoplast-mediated transformation for transient expression studies

  • Biolistic transformation for varieties recalcitrant to Agrobacterium

4. Analysis of Edited Plants:

5. Advanced Strategies:

  • Multiplex editing to target multiple transporters simultaneously (e.g., both ADP/ATP and phosphate carriers)

  • Tissue-specific knockout using tissue-specific promoters driving Cas9

  • Inducible CRISPR systems for temporal control of gene disruption

Given the potential essential nature of the ADP/ATP carrier (as seen with TbMCP5 in T. brucei ), researchers should consider inducible or partial knockdown strategies rather than constitutive knockout approaches, particularly when investigating basic functions.

How does the rice ADP/ATP carrier protein interact with other components of the mitochondrial respiratory chain?

The rice ADP/ATP carrier protein interacts both functionally and physically with various components of the mitochondrial respiratory chain to coordinate energy production and utilization. Although specific interaction data for the rice carrier is limited in the provided search results, the conserved nature of mitochondrial function allows us to describe the likely interactions:

Functional Interactions:

  • ATP Synthase (Complex V): The ADP/ATP carrier functionally couples with ATP synthase by:

    • Importing ADP that serves as a substrate for ATP synthase

    • Exporting newly synthesized ATP from the matrix

    • Creating a cycle that maintains optimal nucleotide concentrations for ATP synthesis

  • Respiratory Complexes (I-IV): These complexes generate the proton gradient that drives ATP synthesis. The ADP/ATP carrier indirectly regulates their activity through:

    • The "respiratory control" mechanism - ADP import stimulates respiratory chain activity

    • Maintaining matrix ATP levels that can allosterically regulate respiratory complex activities

  • Phosphate Carrier: As indicated in studies of other organisms, there is coordinated activity between the ADP/ATP carrier and phosphate carriers (like TbMCP11) . This coordination ensures that:

    • Sufficient phosphate is available in the matrix for ATP synthesis

    • The stoichiometry of ADP/ATP exchange is balanced with phosphate import

Physical Interactions and Supercomplexes:

While not explicitly detailed for rice in the provided search results, research in other systems has shown that mitochondrial carriers can associate with larger supercomplexes. These interactions may include:

  • Association with the ATP synthasome (a supercomplex of ATP synthase, phosphate carrier, and ADP/ATP carrier)

  • Interactions with mitochondrial contact site and cristae organizing system (MICOS) components

  • Potential interactions with mitochondrial quality control proteins

Understanding these interactions is critical for comprehending the integrated function of mitochondrial energy production in rice, particularly under stress conditions where energy demands and mitochondrial function may be significantly altered.

What is the role of the rice ADP/ATP carrier in ethylene-mediated stress responses?

The rice ADP/ATP carrier protein likely plays a significant role in ethylene-mediated stress responses, connecting mitochondrial energy metabolism with plant hormone signaling pathways. While specific data on the rice carrier (Os02g0718900) in ethylene responses is not directly presented in the search results, we can derive insights from related research:

Ethylene Signaling and Mitochondrial Function:

  • Ethylene is a key plant hormone involved in various stress responses, including flooding, which is a common stress for rice . The hormone triggers adaptive responses that often have substantial energetic requirements.

  • During flooding stress in rice, ethylene signaling activates adaptive responses that can include:

    • Shifts in energy metabolism

    • Changes in respiratory pathways

    • Alterations in mitochondrial function to cope with reduced oxygen availability

Potential Mechanisms of ADP/ATP Carrier Involvement:

  • Regulation of Expression: Ethylene signaling may modulate the expression of the ADP/ATP carrier gene. Light signaling, which interacts with ethylene pathways, has been shown to affect the expression of genes involved in hormone biosynthesis and energy metabolism .

  • Post-translational Modifications: Ethylene-activated signaling cascades might lead to modifications of the carrier protein, altering its transport kinetics or abundance in the mitochondrial membrane.

  • Metabolic Reprogramming: During stress, ethylene triggers metabolic shifts that change ATP production and consumption patterns, potentially requiring adjusted ADP/ATP transport across the mitochondrial membrane.

The connection between ethylene and energy metabolism is particularly relevant for rice, as it must frequently respond to flooding stress, which triggers ethylene production and requires significant metabolic adaptations. The ADP/ATP carrier would serve as a crucial link between mitochondrial energy production and the cellular energy needs during these adaptive responses.

Further research specifically targeting the rice ADP/ATP carrier's role in ethylene responses would help elucidate these connections more precisely.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.