Recombinant Oryza sativa subsp. japonica Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; LOC_Osp1g00480; Nip074; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLANKPVDIEVPQAVLPDTVFEAVLRIPYDMQLKQV LANGKKGGLNVGAVLILPEGFELAPPDRISPELKEKIGNLSFQSYRPNKKNILVIGPVPG KKYSEIVFPILSPDPAMKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATSTGVVR KILRKEKGGYEISIVDASDGRQVIDLIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFFASVILAQVFLVLKKKQFEKVQLYEMNF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is apocytochrome f and what is its function in rice?

Apocytochrome f is the precursor protein of cytochrome f, which serves as an essential component of the photosynthetic electron transport chain in plants. In rice (Oryza sativa), as in other photosynthetic organisms, this protein undergoes a multistep biosynthesis process that includes processing of the precursor protein and covalent ligation of a c-heme upon membrane insertion . The mature cytochrome f functions as an electron carrier within the cytochrome b6f complex, playing a critical role in photosynthesis by facilitating electron transfer between photosystem II and photosystem I.

How does the structure of apocytochrome f relate to its function?

The structure of apocytochrome f is highly specialized for its role in electron transport. Upon processing, the precursor form undergoes significant structural changes. Crystal structure studies have revealed that one axial ligand of the c-heme is provided by the alpha-amino group of Tyr1, which is generated upon cleavage of the signal sequence from the precursor protein . This unique structural arrangement is critical for proper electron transfer function. The protein contains specific cysteinyl residues responsible for covalent ligation of the c-heme, which can be studied through site-directed mutagenesis approaches, as demonstrated in Chlamydomonas reinhardtii .

What expression systems are suitable for producing recombinant rice apocytochrome f?

The production of functional recombinant apocytochrome f requires expression systems capable of executing proper post-translational modifications, particularly for membrane proteins with complex processing requirements. Based on studies with similar proteins, suitable expression systems include:

Expression SystemAdvantagesLimitations
Chloroplast transformation in plantsNative environment, proper processing machinerySlow growth, lower yields
E. coli with specialized vectorsRapid growth, established protocolsPotential folding issues with membrane proteins
Yeast expression systemsEukaryotic processing capabilityMay require optimization for plant proteins
Cell-free systemsControl over reaction conditionsMay lack complete processing machinery

Chloroplast transformation has been successfully used for studying apocytochrome f biosynthesis and can be an appropriate system for obtaining properly processed recombinant protein .

What techniques are essential for confirming the identity and quality of recombinant apocytochrome f?

Several analytical techniques should be employed to ensure the identity and quality of recombinant apocytochrome f:

  • SDS-PAGE and Western blotting to confirm molecular weight and immunoreactivity

  • Mass spectrometry to verify primary sequence and post-translational modifications

  • Spectrophotometric analysis to assess heme incorporation

  • Circular dichroism to evaluate secondary structure

  • Functional assays to confirm electron transfer capability

When working with recombinant proteins, comparing structural features with the native form is essential, as subtle structural discrepancies can affect protein function and behavior in experimental systems .

How can site-directed mutagenesis be applied to study functional domains of rice apocytochrome f?

Site-directed mutagenesis is a powerful approach for investigating structure-function relationships in apocytochrome f. Based on established protocols with cytochrome f:

  • Target the cysteinyl residues responsible for heme ligation to study the relationship between heme binding and protein processing. Previous research has demonstrated that substituting these residues with valine and leucine revealed that heme binding is not a prerequisite for cytochrome f processing .

  • Modify the consensus cleavage site for the thylakoid processing peptidase to investigate processing kinetics. Studies have shown that replacing the AQA sequence with LQL resulted in delayed processing but did not prevent heme binding or complex assembly .

  • Investigate the C-terminal membrane anchor, which appears to regulate protein synthesis rates and may affect stability and membrane integration .

A systematic mutagenesis approach should prioritize conserved residues identified through sequence alignment of apocytochrome f across plant species, focusing on domains predicted to be involved in protein-protein interactions or electron transfer.

What is the relationship between phytochrome signaling and apocytochrome f expression in rice?

Phytochromes are photoreceptors that regulate multiple developmental processes in plants. While direct regulation of apocytochrome f by phytochromes has not been explicitly documented, research on rice phytochrome genes (PHYA and PHYB) provides valuable insights into potential regulatory mechanisms:

  • The double mutant phyA phyB shows significantly reduced fertility due to defects in anther and pollen development .

  • Transcriptome analysis of these mutants revealed altered metabolic profiles, particularly in carbohydrate metabolism, which could indirectly affect photosynthetic apparatus development and maintenance, including apocytochrome f expression .

  • The synergistic effects of PHYA and PHYB suggest that multiple light signaling pathways may converge to regulate chloroplast development and photosynthetic protein expression.

Researchers investigating light-dependent regulation of apocytochrome f should consider these phytochrome-mediated pathways as potential indirect regulators of protein expression and function.

How can researchers optimize experimental conditions to study membrane integration of apocytochrome f?

Studying membrane integration of apocytochrome f presents technical challenges due to its hydrophobic nature and complex processing requirements. An optimized experimental approach should include:

Experimental AspectRecommended ApproachRationale
Isolation methodGentle detergent solubilization (digitonin or n-dodecyl-β-D-maltoside)Preserves native protein-protein interactions
Membrane fraction preparationDifferential centrifugation with sucrose gradientSeparates thylakoid membrane fractions
Protein labelingIn vivo pulse-chase with radioactive amino acidsEnables tracking of processing kinetics
Visualization techniqueBlue native PAGE followed by Western blottingPreserves complex integrity during analysis
Functional assessmentElectron transfer assays with artificial electron donors/acceptorsConfirms proper integration and function

Researchers should monitor both the precursor and processed forms, as both can potentially bind heme and assemble into functional complexes under certain conditions .

What are the mechanisms that regulate degradation of misfolded apocytochrome f in chloroplasts?

Studies have shown that degradation of misfolded forms of cytochrome f occurs through a proteolytic system intimately associated with thylakoid membranes . Based on this knowledge, researchers should consider:

  • The role of membrane-associated proteases in quality control of apocytochrome f.

  • The relationship between protein folding, heme attachment, and susceptibility to degradation.

  • How mutations affecting the C-terminal membrane anchor influence protein stability and turnover rates.

  • The potential involvement of chloroplast chaperones in determining whether misfolded proteins are refolded or targeted for degradation.

Comparing degradation rates of various mutant forms can provide insights into the structural elements that trigger recognition by the quality control machinery.

How can recombinant apocytochrome f be used to study the assembly of the cytochrome b6f complex?

Recombinant apocytochrome f provides a valuable tool for investigating the assembly process of the cytochrome b6f complex:

  • By introducing tagged versions of the protein, researchers can perform pull-down assays to identify assembly intermediates and interaction partners.

  • Time-course studies following induction of recombinant protein expression can reveal the sequential steps in complex assembly.

  • Competition assays between wild-type and mutant forms can identify critical regions for protein-protein interactions within the complex.

  • Cross-linking studies with recombinant protein variants can map the spatial arrangement of subunits during the assembly process.

This approach has revealed that both precursor and processed forms of cytochrome f can fold in assembly-competent conformations under certain conditions, suggesting flexibility in the assembly pathway .

What lessons can be learned from rice recombinant protein systems for molecular pharming?

Rice has emerged as a promising system for molecular pharming, as demonstrated by the successful production of recombinant human serum albumin (HSA). The recombinant HSA produced in rice (OsrHSA) has been shown to be identical to plasma-derived HSA in terms of physical and biochemical features . This success provides important insights that can be applied to other recombinant proteins, including apocytochrome f:

  • Transgenic rice provides a cost-effective solution for producing recombinant proteins .

  • Large-scale, GMP-compliant manufacturing and quality control systems have been established for rice-based recombinant proteins .

  • Subtle structural discrepancies may exist between recombinant and native proteins, potentially affecting their properties and applications .

Researchers working with recombinant apocytochrome f should consider these factors when designing expression systems and evaluating protein quality.

How might genomic approaches enhance our understanding of petA gene function in rice?

Genomic approaches can provide valuable insights into the regulatory networks controlling petA gene expression and function:

  • QTL analysis has been used to identify resistance loci for major rice diseases , and similar approaches could identify loci affecting photosynthetic efficiency linked to petA function.

  • Meta-QTL analysis can integrate multiple studies to identify gene clusters with potential functional relationships to photosynthetic genes .

  • Functional analysis of meta-QTL regions can reveal enriched gene ontologies and defense-related genes that might interact with photosynthetic apparatus components .

  • Transcriptome analysis of mutants with altered photosynthetic capacity can identify regulatory networks involving petA .

These approaches can help identify novel candidates for genetic engineering to improve photosynthetic efficiency in rice.

What are the emerging technologies that could advance research on recombinant apocytochrome f?

Several cutting-edge technologies show promise for advancing research on recombinant apocytochrome f:

TechnologyApplication to Apocytochrome f ResearchPotential Impact
Cryo-EMHigh-resolution structural analysis of membrane-integrated proteinReveal dynamic aspects of protein function
CRISPR/Cas9Precise genome editing of petA gene and regulatory elementsGenerate novel mutants for functional studies
Single-molecule techniquesTracking electron transfer in individual protein complexesUncover heterogeneity in functional properties
Synthetic biologyDesign of minimal photosynthetic units with engineered apocytochrome fCreate customized electron transport systems
Computational modelingSimulation of protein dynamics and electron transfer propertiesPredict effects of mutations on function

By integrating these technologies, researchers can develop a more comprehensive understanding of apocytochrome f structure, function, and regulation in rice.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.