Recombinant Oryza sativa subsp. japonica Aquaporin NIP1-4 (NIP1-4)

Shipped with Ice Packs
In Stock

Description

Functional Role in Brucella Pathogenesis

  • Iron Acquisition: Linked to siderophore transport systems essential for intracellular survival .

  • Metabolic Adaptation: Supports survival under host-induced stress (e.g., low pH, nutrient deprivation) .

  • Virulence Regulation: ABC transporters often interact with virulence factors like the VirB type IV secretion system .

Notably, Brucella mutants lacking ABC transporter components exhibit attenuated virulence in macrophages and animal models .

3.1. Vaccine Development

Recombinant Brucella proteins are extensively studied as subunit vaccine candidates . For example:

  • Immune Response Activation: Recombinant proteins like L7/L12 and Omp16/19/28 induce Th1-polarized immunity in murine models .

  • Protective Efficacy: Multi-antigen combinations show synergistic protection against B. abortus and B. suis challenges .

While BRA1188/BS1330_II1179 has not been directly tested in vaccines, its structural conservation across Brucella species makes it a candidate for future studies .

3.2. Diagnostic Tool Development

The protein’s immunogenicity allows its use in ELISA-based serodiagnostics to detect Brucella-specific antibodies .

Assay PerformanceDetails
SensitivityValidated against Brucella-positive sera
SpecificityNo cross-reactivity with Brucella-negative sera

3.3. Mechanistic Studies

  • Protein-Protein Interactions: Yeast two-hybrid and pull-down assays identify binding partners in Brucella membrane complexes .

  • Gene Knockout Models: Used to assess BRA1188’s contribution to bacterial fitness in vitro and in vivo .

Comparative Genomic Insights

Genomic analysis of Brucella suis 1330 reveals that BRA1188/BS1330_II1179 is located on chromosome II (locus tag: BS1330_II1179) . Key findings include:

  • Sequence Conservation: 100% identity with homologs in B. abortus and B. melitensis .

  • Transcriptional Regulation: Co-expressed with virulence-associated genes under acidic pH conditions mimicking phagosomal environments .

Limitations and Future Directions

  • Functional Data Gap: The exact biological role of BRA1188/BS1330_II1179 in Brucella metabolism or virulence remains unconfirmed .

  • Therapeutic Potential: Requires in vivo validation to assess its efficacy as a vaccine or drug target .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply for this service.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development accordingly.
Synonyms
NIP1-4; Os06g0552700; LOC_Os06g35930; P0427B07.13; Aquaporin NIP1-4; NOD26-like intrinsic protein 1-4; OsNIP1;4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-273
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
NIP1-4
Target Protein Sequence
MARREVDDSYTNGSVVEVVSIEEGSKMDKEDDHQNPQAPDGGDVVVCGMPMSFTFLQMLLAEFLATFFLMFAGLGAITVEEKKGAVTFPGVAVAWGAAVMAMVYAVGHVSGAHLNPAVTLGFAVAGRFPWRRAPAYALAQTAAATAASVVLRLMFGGRHAPVPATLPGGAHAQSLVIEFVITFYLMFVIMAVATDDQAVGHMAGVAVGGTIMLNVLFAGPVSGASMNPARSIGPALVGSKYTALWVYILGPFAGAAAGAWAYSLIRLTGDRTD
Uniprot No.

Target Background

Function
Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.
Database Links
Protein Families
MIP/aquaporin (TC 1.A.8) family, NIP (TC 1.A.8.12) subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in leaves.

Q&A

How does NIP1-4 function in rice water transport compared to other aquaporin isoforms?

NIP1-4 functions as a specialized channel that facilitates the movement of water and potentially small uncharged solutes across cellular membranes in rice plants. While PIPs are generally the primary water transporters in plants, NIPs like NIP1-4 have evolved more diverse substrate specificity profiles .

Research using stopped-flow spectrophotometry has demonstrated that different rice aquaporin isoforms exhibit varied water transport activities, suggesting they play distinct roles in water movement across different tissues and cell types . Unlike some PIPs that show high water transport activity, NIPs often display moderate water permeability but may transport other substrates such as glycerol, ammonia, or silicon.

What expression systems are optimal for producing functional Recombinant Aquaporin NIP1-4?

The most widely validated expression system for Recombinant Oryza sativa subsp. japonica Aquaporin NIP1-4 is E. coli . This prokaryotic system offers several advantages for aquaporin expression:

  • High protein yield

  • Relatively simple scaling procedures

  • Cost-effectiveness for research applications

  • Well-established protocols for membrane protein expression

For optimal expression in E. coli, the following parameters should be carefully controlled:

ParameterRecommended ConditionRationale
Expression temperature18-25°CLower temperatures reduce inclusion body formation
Induction0.1-0.5 mM IPTGModerate induction prevents toxicity
Expression time4-16 hoursLonger times at lower temperatures improve folding
E. coli strainBL21(DE3), C41(DE3), C43(DE3)Strains engineered for membrane protein expression

The protein is typically produced with an N-terminal His-tag (6× or 10×) to facilitate purification while minimizing interference with the protein's C-terminal region, which is important for trafficking in native conditions .

What purification strategy yields the highest purity and functional integrity of NIP1-4?

A multi-step purification strategy is recommended for obtaining high-purity, functionally active NIP1-4 protein:

  • Membrane fraction isolation: Differential centrifugation to separate the membrane fraction containing the expressed NIP1-4 protein.

  • Solubilization: Careful selection of detergents is critical. Mild detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) at concentrations of 1-2% typically preserve protein structure and function.

  • Affinity chromatography: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin effectively captures the His-tagged protein .

  • Size exclusion chromatography: As a polishing step to remove aggregates and achieve >90% purity as verified by SDS-PAGE .

  • Quality control: Western blotting with anti-His antibodies and functional assays (water transport measurement using proteoliposomes or yeast expression systems) to verify protein integrity.

The final purified protein should be stored in a stabilizing buffer containing 0.05-0.1% detergent to maintain the protein in a solubilized state .

What are the optimal storage conditions to maintain NIP1-4 stability and functionality?

Preserving the stability and functionality of Recombinant Aquaporin NIP1-4 requires careful attention to storage conditions:

For short-term storage (up to one week):

  • Store working aliquots at 4°C

  • Maintain in appropriate buffer conditions

  • Avoid repeated freeze-thaw cycles

For long-term storage:

  • Store at -20°C/-80°C

  • Add 5-50% glycerol as a cryoprotectant (with 50% being commonly used)

  • Aliquot into single-use volumes to avoid freeze-thaw cycles

The shelf life of lyophilized NIP1-4 protein is typically 12 months at -20°C/-80°C, while liquid preparations generally maintain stability for up to 6 months under proper storage conditions .

What reconstitution protocols maximize protein functionality for experimental applications?

For optimal reconstitution of lyophilized NIP1-4 protein:

  • Initial preparation:

    • Briefly centrifuge the vial prior to opening to bring contents to the bottom

    • Allow the vial to reach room temperature before opening

  • Reconstitution procedure:

    • Dissolve in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% for stability

    • Avoid vigorous mixing that may cause protein denaturation; instead, gently invert or rotate

  • Buffer optimization:

    • Tris/PBS-based buffer at pH 8.0 has been validated for NIP1-4 stability

    • The buffer may be supplemented with low concentrations of detergent (0.01-0.05%) to maintain protein solubility

  • Functional verification:

    • Verify protein integrity by SDS-PAGE

    • For functional studies, reconstitution into proteoliposomes may be necessary

Reconstituted protein should be stored as small working aliquots to minimize freeze-thaw cycles that can compromise protein structure and function .

What methodologies are effective for assessing the water transport activity of NIP1-4?

Multiple complementary approaches can be employed to assess the water transport activity of Aquaporin NIP1-4:

  • Stopped-flow spectrophotometry:
    This technique measures the rate of volume change in vesicles containing the aquaporin when subjected to an osmotic gradient . It provides quantitative kinetic data on water permeability:

    ParameterTypical Values for AquaporinsDetection Method
    Pf (osmotic water permeability)10-150 μm/sLight scattering changes
    Activation energy (Ea)3-6 kcal/mol for channel-mediated transportTemperature dependence
  • Yeast expression system assay:
    Heterologous expression in yeast followed by stopped-flow analysis of water transport rates in yeast protoplasts or spheroplasts . This system allows for:

    • Comparative analysis between different aquaporin isoforms

    • Assessment of regulatory mechanisms by co-expressing regulatory components

    • Determination of inhibitor sensitivity

  • Xenopus oocyte swelling assay:
    While not explicitly mentioned in the search results, this is a gold standard for aquaporin functional analysis, measuring volume changes in oocytes expressing the aquaporin when placed in hypotonic solution.

  • Proteoliposome-based assays:
    Reconstitution of purified NIP1-4 into artificial liposomes followed by stopped-flow spectrophotometry provides a defined system for studying transport properties.

These methodologies should be performed under various pH, temperature, and inhibitor conditions to fully characterize the functional properties of NIP1-4 .

How can researchers investigate the selectivity and permeability of NIP1-4 to substrates beyond water?

NIPs are known for their diverse substrate specificity beyond water. To investigate these properties:

  • Transport assays with labeled substrates:

    • Radiolabeled substrate uptake (e.g., 14C-glycerol, 14C-boric acid)

    • Fluorescently labeled substrate transport monitoring

  • Electrophysiological measurements:

    • Patch-clamp analysis of reconstituted NIP1-4 in artificial bilayers

    • Two-electrode voltage-clamp recordings in Xenopus oocytes expressing NIP1-4

  • Computational approaches:

    • Molecular dynamics simulations to predict pore size and substrate interactions

    • Homology modeling based on structurally characterized aquaporins

  • Mutational analysis:

    • Site-directed mutagenesis of key residues in the selectivity filter

    • Creation of chimeric proteins to identify domains responsible for specific substrate selectivity

  • Competition assays:

    • Measuring inhibition of water transport in the presence of potential substrates

    • Analysis of substrate flux in the presence of competitive inhibitors

The experimental outcomes should be correlated with structural features of NIP1-4, particularly the composition of the aromatic/arginine (ar/R) selectivity filter, which largely determines substrate specificity in plant aquaporins.

What techniques effectively determine the subcellular localization of NIP1-4 in plant tissues?

Understanding the subcellular localization of Aquaporin NIP1-4 is essential for elucidating its physiological role. Several complementary techniques can be employed:

  • Immunocytochemistry with isoform-specific antibodies:

    • Using antibodies that specifically recognize NIP1-4 without cross-reactivity to other aquaporins

    • Visualization through fluorescence or electron microscopy

    • Differential labeling of subcellular compartments for co-localization studies

  • Fluorescent protein fusion approaches:

    • Generation of NIP1-4-GFP (or other fluorescent protein) fusions

    • Transient expression in plant protoplasts or stable transformation of rice plants

    • Live-cell imaging to track localization and dynamics

  • Subcellular fractionation and immunoblotting:

    • Isolation of membrane fractions (plasma membrane, tonoplast, ER, etc.)

    • Detection of NIP1-4 in specific fractions using isoform-specific antibodies

    • Correlation with marker proteins for different membrane types

  • Immunogold electron microscopy:

    • Ultra-high resolution detection of NIP1-4 in plant cell ultrastructure

    • Precise quantification of protein distribution across different membranes

Previous studies with rice aquaporins have successfully employed isoform-specific antibodies to determine tissue- and cell-specific localization patterns, suggesting similar approaches would be effective for NIP1-4 .

How does NIP1-4 expression vary across different rice tissues and developmental stages?

Tissue- and developmental-specific expression patterns of Aquaporin NIP1-4 provide important insights into its physiological roles:

Expression analysis can be performed using:

  • Quantitative RT-PCR:

    • Tissue-specific expression profiling across different plant organs

    • Monitoring expression changes during developmental progression

    • Analysis of expression under different environmental conditions

  • Immunoblotting with isoform-specific antibodies:

    • Quantification of protein levels in different tissues and developmental stages

    • Correlation of protein accumulation with physiological functions

    • Detection of post-translational modifications that may affect function

  • Promoter-reporter gene fusions:

    • Analysis of NIP1-4 promoter activity using GUS or luciferase reporters

    • Histochemical or luminescence imaging to visualize expression patterns

    • Identification of tissue-specific regulatory elements

  • RNA-seq and transcriptomic analysis:

    • Genome-wide expression profiling to compare NIP1-4 with other aquaporins

    • Co-expression network analysis to identify functionally related genes

Studies of rice aquaporins have revealed that different isoforms show distinct tissue- and cell-specific accumulation patterns, suggesting specialized roles in water transport across different plant organs . While specific data for NIP1-4 is limited in the provided search results, similar approaches can be applied to characterize its expression profile.

How can NIP1-4 be utilized in studies of plant water relations under drought stress?

Recombinant Aquaporin NIP1-4 serves as a valuable tool for investigating plant responses to drought stress:

  • Transgenic approaches:

    • Overexpression or knockout of NIP1-4 in rice plants to assess impact on drought tolerance

    • Analysis of phenotypic changes in water use efficiency and drought response

    • Measurement of physiological parameters (stomatal conductance, hydraulic conductivity)

  • Proteoliposome-based water transport assays:

    • Reconstitution of purified NIP1-4 into proteoliposomes

    • Measurement of water transport activity under conditions mimicking drought stress

    • Testing the effects of stress-induced signaling molecules on NIP1-4 activity

  • Structure-function analyses:

    • Using recombinant NIP1-4 to identify key residues involved in water transport

    • Investigating how post-translational modifications affect protein function during stress

    • Development of molecular models for drought-responsive aquaporin regulation

  • Interaction studies:

    • Identification of protein interaction partners that may regulate NIP1-4 under stress

    • Analysis of how these interactions change during drought stress

    • Reconstitution of regulatory complexes in vitro to study functional consequences

Understanding NIP1-4's role in drought responses contributes to developing strategies for improving crop water use efficiency and stress tolerance.

What approaches are effective for investigating post-translational regulation of NIP1-4 activity?

Aquaporin activity is often regulated post-translationally in response to environmental stimuli. To investigate these regulatory mechanisms for NIP1-4:

  • Phosphorylation analysis:

    • Identification of phosphorylation sites using mass spectrometry

    • Site-directed mutagenesis of putative phosphorylation sites

    • In vitro phosphorylation assays with recombinant protein and purified kinases

    • Functional assessment of phosphorylation effects on water transport activity

  • pH-dependent regulation:

    • Measurement of water transport activity across a pH range

    • Identification of pH-sensing residues through mutagenesis

    • Correlation with cytosolic pH changes during stress responses

  • Protein trafficking and membrane dynamics:

    • Analysis of NIP1-4 redistribution between membranes under stress

    • Visualization using fluorescent protein fusions

    • Identification of trafficking signals and interacting proteins

  • Heterologous expression systems for regulatory studies:

    • Reconstitution of regulatory pathways in yeast or Xenopus oocytes

    • Co-expression of NIP1-4 with regulatory components

    • Functional assessment of water transport under different conditions

These approaches can reveal how NIP1-4 activity is fine-tuned in response to environmental changes, contributing to our understanding of plant water relations and stress adaptations.

What are common challenges in maintaining NIP1-4 functionality during purification and how can they be addressed?

Membrane proteins like Aquaporin NIP1-4 present several challenges during purification:

  • Protein aggregation and misfolding:

    • Problem: Tendency to aggregate during extraction and purification

    • Solution: Use mild detergents (DDM, OG) at appropriate concentrations; maintain low temperature throughout purification; include glycerol (5-10%) in buffers

  • Loss of activity during purification:

    • Problem: Functional deterioration during multiple purification steps

    • Solution: Minimize purification time; include stabilizing agents (glycerol, specific lipids); avoid harsh detergents; maintain pH near physiological values

  • Low expression yields:

    • Problem: Insufficient protein production in expression systems

    • Solution: Optimize codon usage; use specialized E. coli strains; adjust induction conditions; consider fusion tags that enhance expression

  • Detergent interference with functional assays:

    • Problem: Detergents needed for solubilization may affect functional measurements

    • Solution: Reconstitute protein into proteoliposomes; carefully control detergent concentrations; use detergent-compatible assay systems

  • Protein precipitation during storage:

    • Problem: Formation of precipitates upon storage

    • Solution: Add glycerol (up to 50%); store at appropriate temperature; avoid freeze-thaw cycles; aliquot into single-use volumes

Quality control at each purification step using SDS-PAGE, Western blotting, and pilot functional assays helps identify and address issues early in the purification process.

How can researchers verify the functional integrity of reconstituted NIP1-4 prior to experimental use?

Verifying the functional integrity of reconstituted NIP1-4 is critical before proceeding with experimental applications:

  • Water transport activity assays:

    • Reconstitution into proteoliposomes followed by stopped-flow spectrophotometry

    • Comparison with known active aquaporin controls

    • Measurement of inhibitor sensitivity (e.g., mercury compounds)

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to verify secondary structure content

    • Fluorescence spectroscopy to assess tertiary structure

    • Size exclusion chromatography to confirm monodispersity and proper oligomeric state

  • Thermal stability analysis:

    • Differential scanning calorimetry or thermal shift assays

    • Monitoring stability in different buffer conditions

    • Identification of stabilizing additives

  • Substrate binding assays:

    • Measurement of substrate interaction using isothermal titration calorimetry

    • Intrinsic fluorescence quenching upon substrate binding

    • Surface plasmon resonance studies with potential substrates

  • Reconstitution efficiency evaluation:

    • Protein-to-lipid ratio determination in proteoliposomes

    • Orientation analysis (inside-out vs. right-side-out) in vesicles

    • Freeze-fracture electron microscopy to visualize protein incorporation

Implementing these quality control measures ensures that experimental results reflect the native properties of the protein rather than artifacts of misfolding or inactivation during purification and reconstitution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.