Recombinant Oryza sativa subsp. japonica Aquaporin SIP2-1 (SIP2-1)

Shipped with Ice Packs
In Stock

Description

Functional Roles and Research Findings

SIP2-1 is implicated in stress adaptation and membrane transport, particularly in reproductive tissues.

**2.1 Membrane Localization and Transport Activity

  • Primary Localization: Endoplasmic reticulum (ER) membrane, as shown in Arabidopsis GFP-tagged SIP2;1 studies .

  • Substrate Specificity:

    SubstratePermeabilitySource
    WaterFacilitatedYeast assays
    Hydrogen Peroxide (H₂O₂)FacilitatedYeast assays
    MethylamineBlocked (in OsSIP2-1)Yeast assays

**2.2 Reproductive Tissue Functions

  • Pollen Germination:

    • sip2;1 mutants in Arabidopsis show ~40% reduced germination rates and ~82% shorter pollen tubes compared to wild type (WT) .

    • Complementation with SIP2;1 restores WT-like phenotypes .

  • ER Stress Mitigation:

    • SIP2;1 alleviates ER stress in pollen by regulating BiP3 (Binding Protein 3) mRNA levels, which are elevated under stress .

**2.3 Stress Response in Rice

  • Tissue Expression:

    TissueExpression LevelSource
    AnthersHighHistochemical assays
    Roots/LeavesLowqPCR profiling
  • Stress-Induced Regulation:

    • Upregulated under osmotic shock, salinity, temperature stress, and pathogen attack .

    • Downregulated during dehydration .

**3.1 Research Tools

  • Yeast Complementation: Used to study water/solute transport in fps1Δ mutants .

  • Heterologous Expression: Enables biochemical characterization of SIP2-1’s pore properties .

Challenges and Knowledge Gaps

  • Isoform Confusion: Discrepancy in UniProt IDs (Q7XA61 vs. Q10M80) across sources .

  • Mechanistic Insights: Limited data on SIP2-1’s direct interaction with ER stress pathways in rice.

  • Functional Redundancy: Overlapping roles with other SIPs (e.g., OsSIP1) require further elucidation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SIP2-1; Os03g0320000; LOC_Os03g20410; Aquaporin SIP2-1; OsSIP2;1; Small basic intrinsic protein 2-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
SIP2-1
Target Protein Sequence
MSPAPPPSRGRIRPWLVVGDLVVAAMWVCAGALVKLAVYGVLGLGGRPEADAVKVALSLVYMFFFAWLEGFTGGASYNPLTVLAGALASRAGPSLYLFAAFVRMPAQVFGSILGVKLIRAALPKVGKGAPLSVGVHHGALAEGLATFMVVIVSVTLKKKEMKGFFMKTWISSIWKMTFHLLSSDITGGVMNPASAFAWAYARGDHTTFDHLLVYWLAPLQATLLGVWVVTLLTKPKKIEEEADESKTKKE
Uniprot No.

Target Background

Function

Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.

Database Links

STRING: 39947.LOC_Os03g20410.1

UniGene: Os.53172

Protein Families
MIP/aquaporin (TC 1.A.8) family, SIP (TC 1.A.8.10) subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in leaves and anthers, and at lower levels in roots.

Q&A

What is the subcellular localization of OsSIP2-1 and how does it differ from other aquaporin subfamilies?

OsSIP2-1 is predominantly located in the endoplasmic reticulum (ER) membrane, which distinguishes it from other aquaporin subfamilies that typically localize to different cellular compartments. While primarily ER-localized, studies suggest that transient localization to the plasma membrane cannot be excluded . This differs from PIPs (primarily in plasma membrane) and TIPs (primarily in tonoplast). The ER localization of SIP2-1 has been confirmed through fluorescent protein fusion studies, showing distinct perinuclear and reticular patterns characteristic of the ER network .

When investigating subcellular localization experimentally, researchers should use confocal microscopy with GFP-tagged SIP2-1 constructs and co-localization markers specific for ER (e.g., BiP or calnexin). Subcellular fractionation followed by immunoblotting with SIP2-1-specific antibodies can provide complementary biochemical evidence for ER localization.

What are the key structural features of OsSIP2-1 that determine its substrate selectivity?

The substrate selectivity of OsSIP2-1 is primarily determined by its unique structural features, particularly in the conserved NPA motifs and aromatic/arginine (ar/R) selectivity filter. Unlike canonical aquaporins that contain two conserved NPA motifs, SIP2-1 has modifications in these regions. The first NPA motif in SIP2-1 is replaced with NPL, potentially impacting its solute permeability profile .

The ar/R constriction region, formed by four amino acid residues from different transmembrane helices, creates the narrowest point in the channel and serves as the primary selectivity filter. This structural configuration enables OsSIP2-1 to facilitate the permeation of water and hydrogen peroxide, as demonstrated in heterologous expression studies .

For researchers studying substrate selectivity experimentally, site-directed mutagenesis of these key residues followed by functional assays in heterologous systems is the recommended approach to determine how specific amino acids contribute to transport properties.

How does the expression pattern of OsSIP2-1 vary across different rice tissues and developmental stages?

OsSIP2-1 shows distinct tissue-specific expression patterns in rice. According to expression profiling studies, OsSIP2-1 is preferentially expressed in anthers and exhibits relatively weak expression in other tissues . This contrasts with OsSIP1, which is expressed more uniformly across all tissues tested.

The tissue-specific expression pattern has been verified through histochemical staining of tissues expressing promoter-β-glucuronidase fusion genes, which confirmed the preferential expression in reproductive tissues, particularly anthers . This expression pattern suggests a specialized role for OsSIP2-1 in reproductive development, similar to what has been observed for SIP2;1 in Arabidopsis, which is involved in pollen germination and tube elongation .

For developmental expression analysis, quantitative RT-PCR combined with in situ hybridization provides the most comprehensive approach to track SIP2-1 expression across different developmental stages and tissue types.

What techniques are most effective for detecting native and recombinant OsSIP2-1 protein levels in plant tissues?

For detecting native OsSIP2-1 in plant tissues, immunoblotting using isoform-specific antibodies is the most reliable approach. When developing antibodies, researchers should select unique sequences in either the N- or C-termini, as these regions show the lowest sequence similarities between aquaporin family members .

For recombinant OsSIP2-1 expression, the following methodological approach is recommended:

  • Generate isoform-specific antibodies targeting unique epitopes in the N- or C-terminal regions

  • Validate antibody specificity using recombinant protein and knockout/knockdown lines

  • Extract membrane proteins using appropriate detergents (e.g., 1% Triton X-100 or 0.1% SDS)

  • Perform SDS-PAGE followed by immunoblotting with the validated antibodies

  • Quantify protein levels using densitometry with appropriate internal controls

For enhanced sensitivity, particularly in tissues with low expression levels, immunoprecipitation prior to immunoblotting or mass spectrometry-based approaches can be employed.

What expression systems are optimal for producing functional recombinant OsSIP2-1 protein for structural and functional studies?

Multiple expression systems have been successfully used for producing functional recombinant aquaporins, each with specific advantages for different research applications:

Expression SystemAdvantagesLimitationsApplications
Yeast (S. cerevisiae)- Eukaryotic post-translational modifications
- Compatible with stopped-flow spectrophotometry
- Well-established for aquaporin research
- Lower yield than bacterial systems
- Potential interference from endogenous aquaporins
- Water transport activity assays
- Substrate specificity studies
E. coli- High protein yield
- Simple culture conditions
- Cost-effective
- Lacks eukaryotic post-translational modifications
- Potential protein misfolding
- Large-scale protein production
- Crystallization studies
Insect cells- Advanced eukaryotic post-translational modifications
- High expression levels
- More complex and expensive
- Longer production time
- Structural studies
- Complex functional assays
Plant expression systems- Native-like membrane environment
- Appropriate post-translational modifications
- Lower yield
- More complex transformation procedures
- In planta functional studies
- Protein-protein interaction studies

For functional studies of SIP2-1, yeast expression systems have proven particularly effective, especially when combined with stopped-flow spectrophotometry for water transport measurements . When expressing SIP2-1 in yeast, using the fps1Δ mutant strain enhances sensitivity for permeability assays .

How can researchers accurately measure the substrate transport activity of OsSIP2-1?

Measuring substrate transport activity of OsSIP2-1 requires specialized techniques depending on the substrate of interest. For water permeability, stopped-flow spectrophotometry using yeast spheroplasts or proteoliposomes is the gold standard .

The methodology involves:

  • Expressing SIP2-1 in an appropriate system (yeast cells recommended)

  • Preparing membrane vesicles or spheroplasts containing the recombinant protein

  • Subjecting these vesicles to an osmotic gradient in a stopped-flow apparatus

  • Measuring the kinetics of vesicle shrinkage or swelling as water moves across the membrane

  • Calculating permeability coefficients from the rate constants of the reaction curves

For other substrates like hydrogen peroxide, assays can be adapted using H₂O₂-sensitive fluorescent dyes or by measuring cell survival rates under oxidative stress conditions, as demonstrated in yeast fps1Δ mutants expressing OsSIP2-1 .

When comparing transport activities between different aquaporins, it's essential to normalize measurements based on protein expression levels, which can be determined through quantitative immunoblotting.

How does OsSIP2-1 contribute to rice plant responses to various abiotic stresses?

OsSIP2-1 expression is dynamically regulated in response to various environmental stresses, suggesting a role in stress adaptation mechanisms. Studies have shown that OsSIP2-1 is upregulated under multiple stress conditions, including osmotic shock, high salinity, unfavorable temperature, and redox challenges . Interestingly, dehydration treatment results in reduced expression of OsSIP2-1, indicating a complex regulatory response to water limitation.

The ability of OsSIP2-1 to transport hydrogen peroxide, as demonstrated in yeast expression studies, suggests it may function in redox signaling pathways during stress responses . H₂O₂ is a key signaling molecule in plant stress responses, and controlled transport of H₂O₂ across cellular membranes is crucial for appropriate stress signaling.

For studying OsSIP2-1's role in stress responses, researchers should combine gene expression analysis (qRT-PCR), protein quantification (immunoblotting), and physiological measurements in wild-type and transgenic plants with altered SIP2-1 expression levels under controlled stress conditions.

What is the relationship between OsSIP2-1 and endoplasmic reticulum stress in rice reproductive tissues?

Similar to findings in Arabidopsis, OsSIP2-1 appears to be involved in alleviating ER stress, particularly in reproductive tissues. In Arabidopsis, loss of SIP2;1 function results in increased expression of ER stress markers like BiP3 in pollen, suggesting that SIP2;1 helps mitigate ER stress during pollen development and tube growth .

Given the preferential expression of OsSIP2-1 in rice anthers , a similar function in reproductive tissue development can be hypothesized. The ER undergoes significant reorganization during pollen development and pollen tube growth, processes that likely require regulated water and solute transport across the ER membrane.

To investigate this relationship experimentally, researchers should:

  • Generate OsSIP2-1 knockout or knockdown rice lines

  • Analyze expression of ER stress markers (e.g., BiP3, bZIP60) in reproductive tissues

  • Examine pollen development, germination, and tube growth phenotypes

  • Perform ultrastructural analysis of ER morphology using transmission electron microscopy

  • Test sensitivity to chemical ER stress inducers like tunicamycin or DTT

How do the functional properties of OsSIP2-1 compare with other SIP family members in rice and other plant species?

Comparative analysis of SIP family members reveals both conserved and divergent functional properties:

SIP Family MemberSpeciesLocalizationWater PermeabilityOther SubstratesKey Functions
OsSIP2-1Oryza sativaER membrane (primary)YesH₂O₂, limited methylamineReproductive development, stress response
OsSIP1Oryza sativaER membraneYesH₂O₂, methylamineBroader tissue expression pattern
AtSIP1;1Arabidopsis thalianaER membraneYesNot fully characterizedSupports hydration of pollen on pistil
AtSIP1;2Arabidopsis thalianaER membraneYesNot fully characterizedNot fully characterized
AtSIP2;1Arabidopsis thalianaER membraneLimited dataNot fully characterizedPollen germination and tube elongation
VvSIP1;1Vitis vinifera (grape)ER membraneYesNot fully characterizedWater transport through ER membrane

The most significant difference between OsSIP1 and OsSIP2-1 appears to be in substrate selectivity, particularly regarding methylamine permeability. While OsSIP1 shows subtle permeability to methylamine, OsSIP2-1 expressing yeast cells were unable to efflux toxic methylamine, suggesting OsSIP1 may have a wider conducting pore than OsSIP2-1 .

For comparative functional studies, it is recommended to express multiple SIP family members in the same experimental system and conduct parallel transport assays under identical conditions.

What evolutionary insights can be gained from comparing SIP2-1 sequences across different plant species?

Evolutionary analysis of SIP2-1 sequences across plant species reveals important insights about functional conservation and specialization within this aquaporin subfamily. SIPs represent one of the most divergent aquaporin subfamilies, with unique structural features that distinguish them from other MIPs.

A key evolutionary signature in SIPs is the modification of the conserved NPA motifs. While the first NPA motif in AtSIP1;1 and AtSIP1;2 is replaced with NPT and NPC respectively, in AtSIP2;1 and likely in OsSIP2-1, it is replaced with NPL . These substitutions may have evolved to accommodate specialized functions in the ER membrane.

For evolutionary studies, researchers should:

  • Perform comprehensive phylogenetic analysis of SIP sequences from diverse plant species

  • Identify conserved and variable regions, particularly in selectivity filters and NPA motifs

  • Map conservation patterns onto structural models to identify functionally important residues

  • Compare expression patterns of SIP orthologs across species to identify conserved regulatory mechanisms

  • Use ancestral sequence reconstruction to infer the evolutionary trajectory of SIP specialization

How can CRISPR/Cas9 genome editing be optimized for studying OsSIP2-1 function in rice?

CRISPR/Cas9 genome editing provides powerful approaches for investigating OsSIP2-1 function through targeted genetic modifications. For optimal results when studying OsSIP2-1, consider the following methodological recommendations:

  • Guide RNA design:

    • Target exonic regions near the N-terminus to ensure complete loss of function

    • Design multiple gRNAs (at least 3-4) to increase editing efficiency

    • Verify target specificity to avoid off-target effects, particularly with other aquaporin family members

  • Editing strategies:

    • For complete knockout: Create frameshift mutations in early exons

    • For structure-function studies: Implement precise base editing to modify specific residues in the selectivity filter or NPA motifs

    • For expression studies: Edit promoter regions or introduce reporter genes through homology-directed repair

  • Phenotypic analysis:

    • Focus on reproductive development given the preferential expression in anthers

    • Quantify pollen viability, germination rate, and pollen tube growth

    • Assess seed production and analyze silique/panicle development

    • Measure ER stress marker expression in reproductive tissues

  • Complementation controls:

    • Include wild-type OsSIP2-1 complementation lines

    • Create complementation lines with specific mutations to verify structure-function relationships

    • Use tissue-specific promoters to rescue phenotypes in specific cell types

Given that OsSIP2-1 shows stress-responsive expression, edited lines should be evaluated under multiple environmental conditions to comprehensively characterize its physiological roles.

What are the most promising approaches for resolving the three-dimensional structure of OsSIP2-1?

Resolving the three-dimensional structure of OsSIP2-1 represents a significant challenge but would provide invaluable insights into its transport mechanism and substrate selectivity. Based on structural studies of other aquaporins, the following approaches are most promising:

  • X-ray crystallography:

    • Optimize recombinant expression in a system capable of producing milligram quantities of protein (E. coli or insect cells)

    • Screen multiple detergents for optimal solubilization and stability

    • Employ lipidic cubic phase crystallization, which has been successful for other membrane proteins

    • Consider creating chimeric constructs with crystallization-enhancing proteins like T4 lysozyme

  • Cryo-electron microscopy (cryo-EM):

    • Increasingly viable for membrane proteins of this size (~30 kDa)

    • Prepare samples in nanodiscs or amphipols to maintain native-like membrane environment

    • Use antibody fragments to increase particle size and provide fiducial markers

    • Consider focusing on SIP2-1 tetramers to increase effective molecular weight

  • Integrative structural biology approaches:

    • Combine lower-resolution experimental data with computational modeling

    • Use homology modeling based on solved aquaporin structures

    • Validate models with site-directed mutagenesis and functional assays

    • Apply molecular dynamics simulations to study conformational dynamics

When existing structural data is unavailable, bioinformatic tools like Phyre2 can predict protein structures, and programs like MOLES 2.5 can characterize pores and channels within these models . For SIP2-1, comparative modeling based on the known structures of spinach SoPIP2;1 or Arabidopsis AtPIP2;4 aquaporins would provide a reasonable starting point for structure-based functional studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.