Recombinant Oryza sativa subsp. japonica ASC1-like protein 1 (Os02g0581300, LOC_Os02g37080)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery information.
Note: All protein shipments are accompanied by standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For optimal long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of the protein is influenced by various factors including storage conditions, buffer composition, temperature, and inherent protein stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Os02g0581300; LOC_Os02g37080; OJ1115_A05.19; ASC1-like protein 1; Alternaria stem canker resistance-like protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os02g0581300
Target Protein Sequence
MGVAAAAGRLLAAVDWEREAYPAYRDFFALPLFAVFFLVVRYLLDCFVFEWIGRKLIFGK EKVDYEKEETRKKIRKFKESAWKCVYFLSGEILSLSVTYNEPWFTNTKYFWVGPGDQVWP DQKIKWKLKAVYMYAAGFYTYSIFALMFWETRRSDFGVSMSHHVATVALIVLSYVFRFAR VGSVVLAIHDASDVFLEVGKMAKYSHCDLLANVAFLLFVVSWVLLRLTYFPFWILRSTSY EVLLTLDKKKHNFDGPIYYYVFNSLLFSLLVLHIYWWVLIYRMLVRQIKTRNVGDDVRSD SEGEDEHED
Uniprot No.

Target Background

Function
This protein mediates resistance to sphinganine-analog mycotoxins (SAMs) by restoring sphingolipid biosynthesis. It can salvage the transport of GPI-anchored proteins from the endoplasmic reticulum to the Golgi apparatus in ceramides-depleted cells after SAM exposure.
Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is ASC1-like protein 1 and what is its significance in rice?

ASC1-like protein 1 in Oryza sativa subsp. japonica (rice) is also known as Alternaria stem canker resistance-like protein 1. Based on its naming, it may play a role in disease resistance mechanisms, particularly against fungal pathogens like Alternaria species. The protein is encoded by the gene Os02g0581300 (LOC_Os02g37080) . Understanding this protein is significant for rice research as it could potentially influence plant immunity pathways and stress responses, similar to other stress-associated proteins in rice.

What are the recommended methods for expressing recombinant ASC1-like protein 1?

For successfully expressing recombinant ASC1-like protein 1, researchers should consider the following methodological approaches:

  • Expression system selection: E. coli (BL21 or Rosetta strains) is often used for initial expression attempts, but given the plant origin, insect cell or yeast expression systems may provide better post-translational modifications.

  • Vector design: Incorporate a suitable tag (His, GST, or MBP) to facilitate purification. The tag position (N or C-terminal) should be determined based on structural predictions to avoid interfering with functional domains.

  • Expression conditions: Optimize temperature (typically 16-25°C for plant proteins), IPTG concentration (0.1-1.0 mM), and expression duration (4-24 hours).

  • Protein extraction and purification: Use appropriate buffer systems (typically containing 50 mM Tris, 150-300 mM NaCl, pH 7.5-8.0) with protease inhibitors. Purification can be achieved through affinity chromatography followed by size exclusion chromatography.

Researchers should validate the functional integrity of the recombinant protein through activity assays relevant to its predicted function in stress or defense responses .

How should I design experiments to study the function of ASC1-like protein 1 in rice?

When designing experiments to elucidate the function of ASC1-like protein 1, a comprehensive multi-level approach is recommended:

  • Gene expression analysis:

    • qRT-PCR to measure transcript levels under various stress conditions (biotic, abiotic)

    • RNA-seq for genome-wide expression profiling

    • In situ hybridization to determine tissue-specific expression patterns

  • Protein localization studies:

    • Generate GFP fusion constructs for subcellular localization

    • Perform immunolocalization using specific antibodies

    • Fractionation studies to identify compartment-specific distribution

  • Functional genomics approaches:

    • CRISPR/Cas9-mediated knockout or RNAi-mediated knockdown

    • Overexpression studies using strong constitutive promoters

    • Complementation assays in mutant backgrounds

  • Phenotypic analysis:

    • Challenge transgenic plants with pathogens (especially Alternaria species)

    • Evaluate response to various abiotic stresses (drought, salt, temperature)

    • Assess developmental parameters under normal and stress conditions

This systematic approach follows established experimental design principles by manipulating independent variables (gene expression, stress treatments) and measuring dependent variables (phenotypic responses) . The inclusion of proper controls and randomization ensures experimental validity and reproducibility.

What methods are most effective for studying protein-protein interactions involving ASC1-like protein 1?

To effectively study protein-protein interactions involving ASC1-like protein 1, consider implementing these methodological approaches:

  • In vitro methods:

    • Pull-down assays using recombinant tagged ASC1-like protein 1

    • Surface plasmon resonance (SPR) for kinetic analysis of interactions

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

  • In vivo methods:

    • Yeast two-hybrid screening to identify potential interacting partners

    • Bimolecular fluorescence complementation (BiFC) for visualizing interactions in plant cells

    • Co-immunoprecipitation from plant extracts followed by mass spectrometry

    • Fluorescence resonance energy transfer (FRET) for dynamic interaction studies

  • Computational prediction:

    • Use of interaction prediction algorithms based on protein domains

    • Structural modeling to identify potential interaction interfaces

Based on findings with other rice proteins like stress-associated proteins (SAPs), interaction studies should focus on potential membrane-localized partners and kinases. For example, similar rice proteins have been shown to interact with receptor-like cytoplasmic kinases at the nuclear membrane, plasma membrane, and in the nucleus .

How can I design experiments to study the role of ASC1-like protein 1 under various stress conditions?

To investigate ASC1-like protein 1's role in stress responses, implement the following experimental design:

Experimental design table for stress response studies:

Stress TypeTreatment ConditionsDurationControlKey Measurements
DroughtWithhold water until soil moisture reaches 30% of field capacity0, 3, 7, 14 daysWell-watered plantsGene expression, protein levels, physiological parameters
Salt0, 50, 100, 150 mM NaCl6h, 12h, 24h, 7dNo salt treatmentIon content, oxidative stress markers, gene expression
PathogenAlternaria spore suspension (10^5 spores/ml)0, 12h, 24h, 48h, 72hMock inoculationDisease severity, defense gene expression, ROS production
Heat40°C exposure0, 1h, 3h, 6h, 24h28°C (optimal)HSP expression, membrane stability, photosynthetic efficiency

For each stress condition:

  • Compare wild-type, knockout/knockdown, and overexpression lines

  • Collect tissues at multiple time points for temporal analysis

  • Analyze transcriptome and proteome changes

  • Measure physiological and biochemical parameters relevant to the specific stress

This experimental design incorporates proper controls, time-course analysis, and multiple stress types to comprehensively evaluate ASC1-like protein 1's function in stress responses, following established protocols similar to those used for studying other stress-related proteins in rice .

How might ASC1-like protein 1 interact with actin cytoskeleton dynamics in rice cells?

Based on studies of other rice proteins, ASC1-like protein 1 may potentially interact with the actin cytoskeleton through direct or indirect mechanisms. While specific information about ASC1-like protein 1's interaction with actin is not available in the search results, we can propose methodological approaches to investigate this question based on established protocols for studying actin-interacting proteins in rice:

  • Co-localization studies:

    • Generate fluorescently tagged ASC1-like protein 1 and visualize with actin markers

    • Use high-resolution techniques like STORM or PALM microscopy for detailed co-localization

  • Biochemical interaction analysis:

    • Conduct in vitro actin binding/bundling assays with purified recombinant protein

    • Perform co-sedimentation assays with F-actin to test direct interactions

    • Use pyrene-actin polymerization assays to assess effects on actin dynamics

  • Live-cell imaging approaches:

    • Implement TIRF microscopy to visualize single actin filament dynamics in the presence of ASC1-like protein 1

    • Perform FRAP (Fluorescence Recovery After Photobleaching) to measure actin turnover rates

Studies with Oryza sativa actin-interacting protein 1 (AIP1) have demonstrated that actin turnover regulation is essential for optimal rice growth. Similar experimental approaches could reveal whether ASC1-like protein 1 influences actin dynamics, potentially affecting cellular processes like vesicle trafficking, organelle movement, or cytoplasmic streaming .

What is the relationship between ASC1-like protein 1 and other stress-response proteins in rice?

To investigate the relationship between ASC1-like protein 1 and other stress-response proteins in rice, I recommend the following research methodologies:

  • Comparative expression analysis:

    • Perform RNA-seq under various stress conditions to identify co-expressed genes

    • Use clustering analysis to group genes with similar expression patterns

    • Conduct time-course experiments to establish temporal relationships

  • Protein interaction network analysis:

    • Implement affinity purification-mass spectrometry (AP-MS) to identify protein complexes

    • Use yeast two-hybrid or BiFC to confirm direct interactions

    • Construct interaction networks to visualize relationships

  • Functional redundancy studies:

    • Generate single and multiple gene knockouts of ASC1-like protein 1 and related proteins

    • Conduct complementation assays to test functional equivalence

    • Perform domain swapping experiments to identify critical functional regions

Research on rice stress-associated proteins (SAPs) containing A20/AN1 zinc-finger domains has shown they can interact with receptor-like cytoplasmic kinases and confer abiotic stress tolerance. For example, OsSAP1/11 interacts with OsRLCK253 via the A20 zinc-finger domain, forming complexes at the nuclear membrane, plasma membrane, and in the nucleus that enhance stress tolerance . Investigating whether ASC1-like protein 1 participates in similar interaction networks would be valuable for understanding its role in stress response pathways.

How can advanced imaging techniques be applied to study ASC1-like protein 1 dynamics in living rice cells?

Advanced imaging methodologies for studying ASC1-like protein 1 dynamics in living rice cells include:

  • Super-resolution microscopy approaches:

    • Stimulated emission depletion (STED) microscopy to overcome diffraction limits

    • Single-molecule localization microscopy (PALM/STORM) for nanoscale protein distribution

    • Structured illumination microscopy (SIM) for improved resolution of protein complexes

  • Live-cell protein dynamics techniques:

    • Fluorescence recovery after photobleaching (FRAP) to measure protein mobility

    • Fluorescence loss in photobleaching (FLIP) to analyze protein compartmentalization

    • Single-particle tracking to follow individual protein molecules

  • Protein interaction visualization:

    • Förster resonance energy transfer (FRET) for real-time interaction studies

    • Fluorescence lifetime imaging microscopy (FLIM) to quantify protein interactions

    • Bimolecular fluorescence complementation (BiFC) for stable interaction visualization

  • Sample preparation considerations:

    • Use of rice protoplasts for short-term studies

    • Transgenic rice lines expressing fluorescent protein fusions for in planta studies

    • Microdissection techniques for tissue-specific imaging

Similar imaging approaches have been successfully applied to study protein interactions in rice, such as those between OsSAP1/11 and OsRLCK253, revealing subcellular interactions at the nuclear membrane, plasma membrane, and within the nucleus . These techniques could reveal critical information about ASC1-like protein 1's dynamic behavior during normal growth and under stress conditions.

What are the key considerations for generating specific antibodies against ASC1-like protein 1?

When generating specific antibodies against ASC1-like protein 1, researchers should follow these methodological guidelines:

  • Epitope selection:

    • Perform in silico analysis to identify unique, antigenic regions

    • Select peptides from exposed regions (avoid transmembrane domains)

    • Choose sequences with minimal homology to other rice proteins

    • Consider multiple epitopes (N-terminal, C-terminal, and internal regions)

  • Antibody production strategy:

    • For polyclonal antibodies: Use purified recombinant protein or synthetic peptides conjugated to carrier proteins (KLH or BSA)

    • For monoclonal antibodies: Consider the hybridoma approach for highly specific detection

    • Consider species selection (rabbit, chicken, or goat) based on experiment requirements

  • Validation methods:

    • Western blot analysis with recombinant protein and plant extracts

    • Immunoprecipitation followed by mass spectrometry

    • Immunolocalization in wild-type vs. knockout/knockdown lines

    • Pre-absorption controls with immunizing antigen

  • Troubleshooting common issues:

    • Cross-reactivity: Perform additional purification steps (affinity purification)

    • Low sensitivity: Optimize antibody concentration, incubation conditions

    • High background: Increase blocking agent concentration, optimize washing steps

Proper antibody generation and validation are crucial for reliable protein detection and localization studies, particularly for proteins like ASC1-like protein 1 that may have homologs in the rice proteome .

How can I overcome challenges in purifying active recombinant ASC1-like protein 1?

To address common challenges in purifying active recombinant ASC1-like protein 1, consider implementing these methodological solutions:

  • Solubility issues:

    • Test different solubilization buffers (varying pH, salt concentration, detergents)

    • Use solubility-enhancing tags (MBP, SUMO, TRX)

    • Attempt co-expression with molecular chaperones (GroEL/ES, DnaK/J)

    • Consider on-column refolding protocols if inclusion bodies form

  • Protein stability concerns:

    • Add stabilizing agents to buffers (glycerol 5-10%, reducing agents like DTT or β-ME)

    • Maintain cold temperatures throughout purification

    • Include protease inhibitors to prevent degradation

    • Test different storage conditions (4°C, -20°C, -80°C, with/without glycerol)

  • Purification optimization:

    • Implement a multi-step purification strategy (affinity + ion exchange + size exclusion)

    • Test different affinity resins if using tagged proteins

    • Optimize imidazole concentrations for His-tagged proteins to minimize non-specific binding

    • Consider native purification conditions to maintain structural integrity

  • Activity preservation:

    • Identify buffer conditions that maintain functionality

    • Test activity immediately after purification and after storage

    • Consider adding stabilizing cofactors or binding partners

    • Use activity assays specific to the predicted function of ASC1-like protein 1

This systematic approach addresses the key challenges in protein purification while maintaining the structural and functional integrity of the recombinant protein, which is essential for downstream applications such as biochemical characterization and interaction studies .

What are the best approaches for analyzing ASC1-like protein 1 expression patterns in different rice tissues and developmental stages?

For comprehensive analysis of ASC1-like protein 1 expression patterns across tissues and developmental stages, implement these methodological approaches:

  • Transcriptional analysis methods:

    • qRT-PCR with tissue-specific RNA extracts and developmental series

    • RNA-seq for genome-wide expression correlation analysis

    • In situ hybridization for cellular-level expression localization

    • Promoter-reporter fusion (GUS, LUC) for spatiotemporal expression analysis

  • Protein detection methods:

    • Western blot analysis with tissue-specific protein extracts

    • Immunohistochemistry for tissue and cellular localization

    • Mass spectrometry-based proteomics for quantitative analysis

    • ELISA for quantitative protein measurements across samples

  • Advanced expression analysis approaches:

    • Single-cell RNA-seq for cell-type-specific expression profiles

    • Translating ribosome affinity purification (TRAP) for actively translated mRNAs

    • Chromatin immunoprecipitation (ChIP) to identify transcriptional regulators

    • Protein turnover assays to determine stability in different tissues

  • Experimental design considerations:

    • Sample multiple tissues (roots, shoots, leaves, panicles, seeds)

    • Include key developmental stages (germination, vegetative growth, reproductive)

    • Compare expression under normal and stress conditions

    • Include diurnal time course to identify potential circadian regulation

These approaches provide complementary information about both transcriptional and translational regulation of ASC1-like protein 1, offering insights into its spatial and temporal expression patterns that can inform functional studies and comparative analysis with other stress-related proteins in rice .

How should I analyze and interpret transcriptomic data to understand ASC1-like protein 1 function in stress responses?

When analyzing transcriptomic data to understand ASC1-like protein 1 function in stress responses, implement the following analytical framework:

  • Differential expression analysis:

    • Compare wild-type vs. ASC1-like protein 1 knockout/overexpression lines

    • Identify differentially expressed genes (DEGs) using appropriate statistical methods (DESeq2, edgeR)

    • Analyze expression patterns across multiple stress conditions and time points

    • Create Venn diagrams to identify common and unique DEGs across conditions

  • Functional enrichment analysis:

    • Perform Gene Ontology (GO) enrichment to identify overrepresented biological processes

    • Use KEGG pathway analysis to identify affected metabolic and signaling pathways

    • Implement gene set enrichment analysis (GSEA) for pathway-level changes

    • Create enrichment maps to visualize relationships between enriched terms

  • Co-expression network analysis:

    • Build co-expression networks to identify genes with similar expression patterns

    • Identify hub genes and modules associated with stress responses

    • Compare network topology between genotypes and conditions

    • Integrate with protein-protein interaction data when available

  • Integration with existing knowledge:

    • Compare results with known stress-responsive pathways in rice

    • Look for overlaps with pathways regulated by other stress-associated proteins

    • Similar rice proteins like OsSAP11 have been shown to affect the expression of numerous endogenous genes involved in stress tolerance

Example table for interpreting transcriptomic data:

Analysis TypeKey FindingsBiological InterpretationFollow-up Experiments
DEG Analysisx genes up-regulated, y genes down-regulated in ASC1 overexpression linesPotential role in regulating [specific pathways]Validate key genes by qRT-PCR
GO EnrichmentEnrichment of terms related to "stress response," "cell wall," "ROS metabolism"ASC1 may regulate cellular protective mechanismsBiochemical assays for specific processes
Co-expressionASC1 co-expressed with genes involved in hormone signalingPotential cross-talk with hormone pathwaysHormone sensitivity assays in transgenic lines
Pathway AnalysisEnrichment of MAPK signaling pathway componentsASC1 may function upstream of MAPK cascadePhosphorylation assays of MAPK components

This comprehensive analytical approach provides a systems-level understanding of ASC1-like protein 1's role in stress response pathways and generates testable hypotheses for functional validation .

What statistical approaches are most appropriate for analyzing phenotypic differences in ASC1-like protein 1 transgenic plants?

For robust statistical analysis of phenotypic differences in ASC1-like protein 1 transgenic plants, implement these methodological approaches:

  • Experimental design considerations:

    • Ensure proper randomization of plants to minimize positional effects

    • Include multiple independent transgenic lines (minimum 3) to account for positional effects

    • Use appropriate sample sizes (power analysis recommended)

    • Include proper controls (wild-type, empty vector transformants)

  • Statistical tests for different data types:

    • Continuous variables (growth measurements, yield): ANOVA followed by post-hoc tests (Tukey's HSD)

    • Count data (seed number, branch number): Generalized linear models with Poisson distribution

    • Survival data (stress tolerance): Kaplan-Meier analysis with log-rank test

    • Time-series data: Repeated measures ANOVA or mixed-effects models

  • Advanced statistical approaches:

    • Principal component analysis (PCA) for multivariate phenotypic data

    • Hierarchical clustering to identify patterns across multiple traits

    • Path analysis to understand relationships between interconnected traits

    • Machine learning approaches for complex trait classification

  • Data visualization and reporting:

    • Box plots with individual data points for distribution visualization

    • Include effect sizes along with p-values

    • Report confidence intervals for major findings

    • Use consistent scales when comparing multiple genotypes/conditions

Example statistical analysis table for ASC1-like protein 1 transgenic rice:

Phenotypic TraitStatistical TestResultInterpretation
Plant heightOne-way ANOVA with Tukey's post-hocF(3,56) = 12.8, p < 0.001Significant height increase in overexpression lines
Drought survivalLog-rank testχ² = 15.6, df = 3, p < 0.01Enhanced survival under drought stress
Yield componentsMANOVAWilk's λ = 0.65, F(12,120) = 4.2, p < 0.001Significant multivariate effect on yield traits
Gene expression (qPCR)Student's t-test with Bonferroni correctionVariable by geneDifferential expression of key stress-responsive genes

How can CRISPR/Cas9 genome editing be optimized for functional studies of ASC1-like protein 1?

To optimize CRISPR/Cas9 genome editing for functional studies of ASC1-like protein 1 in rice, implement the following methodological approaches:

  • sgRNA design optimization:

    • Select multiple target sites across the gene (exons, regulatory regions)

    • Use prediction tools to identify sgRNAs with high on-target efficiency and low off-target potential

    • Consider targeting conserved functional domains for knockout studies

    • For precise editing, design sgRNAs near desired modification sites

  • Delivery and transformation strategies:

    • Optimize Agrobacterium-mediated transformation protocols for specific rice varieties

    • Consider direct delivery methods (particle bombardment, protoplast transformation) for transient assays

    • Use tissue-specific or inducible promoters for controlled expression of Cas9

    • Implement ribonucleoprotein (RNP) delivery for DNA-free editing when appropriate

  • Edited line characterization:

    • Screen primary transformants using PCR-RE assays, T7E1 assays, or amplicon sequencing

    • Confirm mutations by Sanger sequencing of PCR products

    • Assess off-target effects through whole-genome sequencing of selected lines

    • Characterize mosaicism and establish homozygous lines through segregation analysis

  • Advanced editing applications:

    • Base editing for specific nucleotide changes without DSBs

    • Prime editing for precise insertions, deletions, or substitutions

    • Multiplex editing to target ASC1-like protein 1 alongside potential interacting partners

    • CRISPRi/CRISPRa for transcriptional modulation without altering the genome

Example table for CRISPR/Cas9 editing strategies:

Editing GoalCRISPR StrategyTarget RegionExpected OutcomeFunctional Analysis
Gene knockoutStandard CRISPR/Cas9Early exonFrameshift mutationLoss-of-function phenotyping
Domain disruptionPaired nickasesSpecific domainIn-frame deletionDomain-specific function
Promoter analysisCRISPRiPromoter regionReduced expressionExpression regulation
Protein taggingHDR-mediated editingC-terminusFusion proteinLocalization & interaction studies

This comprehensive CRISPR/Cas9 strategy enables precise genetic manipulation of ASC1-like protein 1 for detailed functional characterization in rice, following established experimental design principles .

What are the recommended approaches for identifying and validating downstream targets of ASC1-like protein 1?

To identify and validate downstream targets of ASC1-like protein 1, implement this multi-faceted methodological framework:

  • Transcriptome-based target identification:

    • RNA-seq comparing wild-type vs. knockout/overexpression lines under normal and stress conditions

    • Time-course analysis to identify early vs. late response genes

    • Direct comparison with other stress-responsive proteins like OsSAP11, which affects numerous endogenous genes involved in stress tolerance

    • De novo motif discovery in promoters of differentially expressed genes

  • Protein-DNA interaction studies:

    • Chromatin immunoprecipitation sequencing (ChIP-seq) to identify direct binding sites

    • DNA affinity purification sequencing (DAP-seq) for in vitro binding site identification

    • Electrophoretic mobility shift assay (EMSA) for validation of specific interactions

    • Yeast one-hybrid assays to confirm DNA-protein interactions

  • Protein-protein interaction identification:

    • Co-immunoprecipitation followed by mass spectrometry (Co-IP-MS)

    • Proximity-dependent biotin identification (BioID) or APEX2 for in vivo proximity mapping

    • Split-ubiquitin yeast two-hybrid for membrane protein interactions

    • Fluorescence resonance energy transfer (FRET) for dynamic interaction analysis

  • Functional validation strategies:

    • Dual-luciferase reporter assays for transcriptional regulation

    • Transient expression assays in protoplasts

    • Genetic interaction studies using double mutants

    • Biochemical pathway analysis to connect molecular changes to phenotypes

This comprehensive approach allows researchers to identify both direct and indirect downstream targets, establishing the regulatory network and molecular pathways through which ASC1-like protein 1 influences rice stress responses and development.

How can systems biology approaches be applied to understand ASC1-like protein 1's role in rice stress response networks?

To leverage systems biology for understanding ASC1-like protein 1's role in rice stress response networks, implement these methodological approaches:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, metabolomics, and phenomics data

    • Perform correlation network analysis across multiple data types

    • Use integrative clustering to identify coordinated responses

    • Implement Bayesian network modeling to infer causal relationships

  • Network inference and analysis:

    • Construct gene regulatory networks using time-series expression data

    • Identify network motifs (feed-forward loops, feedback mechanisms)

    • Calculate network parameters (centrality, clustering coefficient) to identify key nodes

    • Compare network topology between normal and stress conditions

  • Comparative systems approaches:

    • Perform cross-species comparison with related stress-response systems

    • Compare with other rice stress-associated proteins like OsSAP1/11

    • Identify conserved and divergent modules across different stress types

    • Map ASC1-like protein 1 into known stress response pathways

  • Predictive modeling:

    • Develop mathematical models of ASC1-like protein 1-regulated pathways

    • Implement flux balance analysis for metabolic impacts

    • Use machine learning to predict phenotypic outcomes from molecular signatures

    • Perform in silico perturbation experiments to generate testable hypotheses

Example of multi-omics integration approach:

Data TypeAnalytical MethodIntegration ApproachExpected Insights
TranscriptomicsDifferential expression, co-expression networksIdentify correlated genes and pathwaysTranscriptional programs regulated by ASC1-like protein 1
ProteomicsProtein abundance, post-translational modificationsCorrelation with transcript changesPost-transcriptional regulation mechanisms
MetabolomicsMetabolite profiling, pathway enrichmentMap changes to biochemical pathwaysDownstream effects on cellular metabolism
PhenomicsMulti-trait analysis, growth modelingConnect molecular changes to phenotypesPhysiological consequences of pathway alterations

This systems biology framework provides a holistic understanding of ASC1-like protein 1's function within the broader stress response network, similar to approaches used to study other stress-associated proteins in rice, revealing both direct interactions and emergent properties of the system .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.