Recombinant Oryza sativa subsp. japonica ATP-dependent zinc metalloprotease FTSH 3, mitochondrial (FTSH3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Oryza sativa subsp. japonica ATP-dependent Zinc Metalloprotease FTSH 3, Mitochondrial (FTSH3)

Recombinant Oryza sativa subsp. japonica ATP-dependent zinc metalloprotease FTSH 3, mitochondrial (FTSH3), is a crucial enzyme involved in the regulation of mitochondrial protein quality control. It belongs to the AAA+ (ATPases associated with diverse cellular activities) family of proteases, which are known for their roles in protein degradation and unfolding. FTSH3 is specifically localized to the mitochondrial matrix-facing inner membrane, where it plays a significant role in the assembly and stability of mitochondrial complexes, particularly Complex I (CI) of the oxidative phosphorylation pathway.

Function and Mechanism of FTSH3

FTSH3 is involved in the disassembly and degradation of Complex I subunits, particularly through its interaction with the PSST subunit of the Q-module domain. This interaction is mediated by the ATPase domain of FTSH3, which is essential for recognizing and unfolding damaged or dysfunctional proteins. The ATPase activity allows FTSH3 to facilitate the turnover of CI subunits, ensuring mitochondrial protein quality control and maintaining the integrity of the oxidative phosphorylation pathway .

Key Features of FTSH3:

  • Localization: Mitochondrial matrix-facing inner membrane.

  • Function: Involved in the disassembly and degradation of Complex I subunits.

  • Mechanism: Direct interaction with PSST via its ATPase domain.

Research Findings on FTSH3

Recent studies have elucidated the mechanism by which FTSH3 regulates Complex I turnover. Using forward genetic approaches in Arabidopsis thaliana, researchers identified that FTSH3 interacts directly with the PSST subunit to mediate the disassembly of the CI matrix arm domain. This interaction is crucial for protein quality control and is dependent on the ATPase function of FTSH3 rather than its proteolytic activity .

Implications and Future Directions

Understanding the role of FTSH3 in mitochondrial protein quality control has significant implications for plant growth and development. Mutations affecting the interaction between FTSH3 and PSST can lead to increased Complex I abundance and activity, impacting plant growth. Future research aims to explore the specificity of FTSH3 in regulating other oxidative phosphorylation complexes and its interaction with other mitochondrial proteases .

Table 2: Potential Future Research Directions

Area of ResearchDescription
Specificity of FTSH3Investigate FTSH3's role in regulating other OXPHOS complexes
Interaction with Other ProteasesExamine how FTSH3 modulates activities of other mitochondrial proteases
Plant Growth ImplicationsStudy the effects of FTSH3 mutations on plant development and stress responses

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
FTSH3; Os01g0842600; LOC_Os01g62500; OsJ_003942; P0406G08.15; ATP-dependent zinc metalloprotease FTSH 3, mitochondrial; OsFTSH3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-802
Protein Length
Full Length of Mature Protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
FTSH3
Target Protein Sequence
GSLLGGHGGLRASSPPLPCGELGFLRSYVTSVIGNRAAVASGAGKGGDWRFLLASRQFRR LFSDKSKKNHGKHSEEENKGKGDESDKSDSKKQSSSGDQWNFEESIKQFKDMIAPLFLFG LLLLSASASSSEQEISFQEFKNKLLEPGLVDHIVVSNKSIAKVYVRSSPSIDRIQDSDIH ITTSHLPGIESPSSYKYYFNIGSVDSFEEKLQEAQKALEIDPHYYVPITYTTEAKWFEEV MKYVPTVLIIGLIYLLGKRIQNGFTVGGGPGKGGRSIFSIGKVQVTKLDKNSKNKVFFKD VAGCDEAKQEIMEFVHFLKNPKKYEELGAKIPKGALLVGPPGTGKTLLAKATAGESGVPF LSISGSDFMEMFVGVGPSRVRNLFQEARQCSPSIVFIDEIDAIGRARGRGGFSGGHDERE STLNQLLVEMDGFGTTSGVVVLAGTNRPDILDKALLRPGRFDRQISIDKPDIKGRDQIFR IYLKKLKLDKEPSFYSQRLAALTPGFAGADIANVCNEAALIAARSEGTLITMQHFESAID RVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYV PNDNLLMTKEQLFDMTCMTLGGRAAEEVLIGKISTGAQNDLEKVTKMTYAQVAVYGFSEK VGLLSFPQREDGFEMSKPYSSQTASIIDTEVREWVAKAYEKTVELIKQHKDQVAQIAELL LEKEVLHQDDLVQVLGERPFKTLEPTNYDRFKQGFQDEDSNRNAELSNADGASSLGEAVA S
Uniprot No.

Target Background

Function
Probable ATP-dependent zinc metallopeptidase.
Database Links
Protein Families
AAA ATPase family; Peptidase M41 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is the subcellular localization of FTSH3 in rice cells?

FTSH3 is specifically localized to the mitochondria in rice cells. Like other FtsH proteins in plants, FTSH3 is targeted to organelles, with all 21 identified FtsH proteins in Arabidopsis and rice being subcellularly targeted to either chloroplast or mitochondria . FTSH3 in rice is an inner membrane-bound AAA+ protease that faces the mitochondrial matrix .

To experimentally verify FTSH3 localization, researchers typically employ the following methods:

  • Fluorescent protein tagging: Creating FTSH3-GFP fusion proteins and observing localization via confocal microscopy

  • Subcellular fractionation: Isolating mitochondria using density gradient and surface charge purification techniques

  • Immunogold electron microscopy: Providing high-resolution localization within the mitochondrial compartments

  • Protease protection assays: Determining the membrane topology of FTSH3

For optimal results, combine at least two independent localization techniques to confirm mitochondrial targeting.

How is FTSH3 structurally organized and what are its functional domains?

FTSH3 is a membrane-bound ATP-dependent zinc metalloprotease with a characteristic domain organization. Based on the available sequence data, FTSH3 consists of 802 amino acids with functional activity residing in the mature protein (residues 22-802) . The protein contains several key structural features:

DomainPosition (aa)Function
N-terminal transmembrane~22-45Anchors protein to inner mitochondrial membrane
ATPase (AAA+)~200-450ATP binding and hydrolysis; substrate unfolding
Zinc metalloprotease~450-650Proteolytic activity
C-terminal region~650-802Substrate recognition and binding

The ATPase function of FTSH3, rather than its proteolytic activity, is crucial for its interaction with the Complex I subunit PSST to mediate the disassembly of the matrix arm domain for turnover . For studying domain functions, site-directed mutagenesis targeting conserved motifs in each domain followed by functional complementation assays is recommended.

What expression patterns does FTSH3 show across different rice tissues?

FTSH3 shows differential expression across various rice tissues, with notable expression patterns related to tissue-specific mitochondrial functions. While direct FTSH3-specific expression data is limited in the search results, analysis of the rice mitochondrial proteome reveals heterogeneity in the expression of nucleus-encoded mitochondrial components in different rice tissues .

For investigating FTSH3 expression patterns, researchers should:

  • Perform RT-qPCR across multiple tissues (roots, shoots, leaves, flowers, developing seeds)

  • Analyze publicly available RNA-seq datasets for tissue-specific expression

  • Create promoter-reporter constructs to visualize spatial expression patterns

  • Conduct western blot analysis with tissue-specific protein extracts

Notably, some mitochondrial components show enhanced expression in photosynthetic tissues, while others display selective anther-enhanced expression, particularly those involved in the decarboxylating segment of the tricarboxylic acid cycle . Examining FTSH3 expression in the context of these tissue-specific patterns may provide functional insights.

How does FTSH3 interact with Complex I subunits to facilitate degradation?

FTSH3 employs a highly specific recognition mechanism to facilitate Complex I degradation through direct interaction with the PSST subunit. This interaction is critical for the regulated disassembly and turnover of the Complex I matrix arm domain in response to oxidative damage .

The interaction mechanism involves:

  • Direct binding: FTSH3 directly interacts with the PSST subunit of Complex I through specific amino acid residues.

  • ATPase-dependent function: The ATPase activity of FTSH3 (not its proteolytic activity) is essential for this interaction.

  • N-terminal domain recognition: The interaction specifically involves the N-terminal domain of PSST.

  • Disassembly facilitation: FTSH3 promotes the unfolding of CI matrix arm subunits to enable their subsequent degradation.

To study this interaction experimentally, researchers should consider:

  • Yeast two-hybrid or split-ubiquitin assays: To verify direct interactions

  • Co-immunoprecipitation followed by mass spectrometry: To identify interaction partners in vivo

  • Site-directed mutagenesis: To map critical residues required for interaction

  • In vitro reconstitution assays: To demonstrate FTSH3-mediated disassembly of purified Complex I

Mutations in either the ATPase domain of FTSH3 or the N-terminal domain of PSST prevent the interaction between these two factors, resulting in slowed turnover of matrix arm subunits and enhanced Complex I subunit abundance and activity .

What approaches can be used for recombinant expression and purification of functional FTSH3?

Obtaining pure, functional FTSH3 protein is essential for biochemical and structural studies. Based on current methodologies, the following approach is recommended:

  • Expression system selection: The E. coli expression system has been successfully used for recombinant FTSH3 production, with the mature form (amino acids 22-802) fused to an N-terminal His tag .

  • Construct design considerations:

    • Clone the coding sequence without the transit peptide (residues 1-21)

    • Add a His-tag for purification (N-terminal tagging has been validated)

    • Consider codon optimization for E. coli expression

    • Include TEV protease cleavage site if tag removal is desired

  • Optimal expression conditions:

    ParameterRecommended condition
    E. coli strainBL21(DE3) or Rosetta for rare codons
    Induction temperature16-18°C
    IPTG concentration0.1-0.5 mM
    Induction duration16-20 hours
    Media supplements0.2% glucose, zinc sulfate (10 μM)
  • Purification protocol:

    • Solubilize membranes with mild detergents (DDM or LMNG)

    • Use IMAC (Ni-NTA) for initial capture

    • Apply ion exchange chromatography for intermediate purification

    • Finish with size exclusion chromatography for homogeneity

    • Store in buffer containing 6% trehalose at pH 8.0 as lyophilized powder

  • Activity verification:

    • ATPase activity assay (malachite green phosphate detection)

    • Proteolytic activity assay (fluorogenic peptide substrates)

    • Structural integrity assessment (circular dichroism)

For reconstitution of purified protein, it's recommended to use deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol as a stabilizing agent for long-term storage at -20°C/-80°C .

How do FTSH3 paralogs and orthologs compare across plant species?

FTSH proteins represent a conserved family across plant species, with interesting evolutionary patterns and functional specialization. Comparative analysis reveals both similarities and differences between rice FTSH3 and its relatives:

  • Paralog comparison in rice:

    • Rice genome contains 9 ftsH genes compared to 12 in Arabidopsis

    • Two pairs of ftsH paralogs exist in rice: OsftsH3/8 and OsftsH4/5

    • Paralogous proteins share >80% sequence similarity, suggesting recent duplication events

  • Ortholog comparison between rice and Arabidopsis:

    • Orthologs share >70% sequence similarity across species

    • Most FtsH proteins can be phylogenetically sorted into eight distinct groups

    • No rice ortholog of AtFtsH12 has been detected, indicating potential functional divergence

  • Conservation analysis:

    FeatureConservation levelNotes
    Exon-intron boundariesHighStrongly conserved within groups
    Functional domainsHighConserved across species
    Intron sequencesLowSignificant differences in base composition and length
    Chromosome distributionMediumPreference for some chromosomes (1, 5 in rice)
  • Functional conservation:

    • Approximately 80% of rice mitochondrial proteins have clear homologs in Arabidopsis

    • Conservation of both known and unknown function proteins suggests maintained roles

    • Divergences may reflect adaptation to different metabolic requirements

For researchers investigating evolutionary aspects, recommended approaches include:

  • Phylogenetic analysis using maximum likelihood methods

  • Synteny analysis to identify chromosomal rearrangements

  • Selection pressure analysis (dN/dS ratios) on coding sequences

  • Expression pattern comparison across species using normalized transcriptome data

What is the role of FTSH3 in mitochondrial protein quality control during oxidative stress?

FTSH3 plays a crucial role in mitochondrial protein quality control, particularly in response to oxidative stress. Complex I (NADH dehydrogenase) is especially prone to oxidative damage, necessitating continuous proteolysis and turnover of its subunits .

The mechanism of FTSH3-mediated quality control includes:

  • Damage recognition: FTSH3 recognizes oxidatively damaged Complex I components through its interaction with the PSST subunit.

  • Selective disassembly: Rather than degrading the entire complex, FTSH3 facilitates selective disassembly of the matrix arm domain.

  • ATPase-dependent unfolding: The ATPase function of FTSH3 is critical for unfolding damaged proteins to make them accessible for degradation.

  • Coordination with other proteases: While FTSH3 initiates the degradation process, it likely works in concert with other mitochondrial proteases for complete proteolysis.

To study FTSH3's role in oxidative stress response, researchers should:

  • Compare wild-type and FTSH3-deficient plants under oxidative stress conditions

  • Monitor Complex I stability and turnover rates using pulse-chase experiments

  • Measure ROS production and oxidative damage markers in mitochondria

  • Analyze the accumulation of damaged proteins using redox proteomics approaches

Interestingly, mutations that prevent the interaction between FTSH3 and PSST slow the turnover rate of matrix arm subunits, resulting in enhanced Complex I subunit abundance and activity . This suggests a potential approach for enhancing respiratory chain activity by modulating FTSH3 function.

How do you design experiments to study FTSH3-mediated disassembly of respiratory complexes?

Studying FTSH3-mediated disassembly of respiratory complexes requires sophisticated experimental approaches that bridge biochemical, structural, and cellular techniques:

  • In vitro reconstitution system:

    • Purify recombinant FTSH3 (wild-type and mutant versions)

    • Isolate intact respiratory complexes from mitochondria

    • Establish an ATP-dependent assay for monitoring disassembly

    • Use analytical techniques (BN-PAGE, SEC-MALS) to track complex integrity

  • Site-directed mutagenesis strategy:

    Target domainMutationsExpected outcome
    ATPase domainWalker A/B motifsImpaired ATP binding/hydrolysis
    Zinc-binding motifHEXXH → AEXXQLoss of proteolytic activity
    Substrate-binding regionConserved residuesDisrupted PSST interaction
    Transmembrane domainHydrophobic → chargedAltered membrane integration
  • Real-time monitoring approaches:

    • Fluorescence resonance energy transfer (FRET) with labeled subunits

    • Single-molecule approaches to observe disassembly events

    • Hydrogen-deuterium exchange mass spectrometry to identify structural changes

    • Cryo-EM to visualize intermediate states of disassembly

  • In vivo validation experiments:

    • Generate FTSH3 mutant lines (CRISPR/Cas9 or TILLING)

    • Apply oxidative stress treatments to induce damage

    • Monitor complex turnover using pulse-chase experiments

    • Assess physiological consequences (respiration rate, ROS production)

A key finding to consider is that the ATPase function of FTSH3, rather than its proteolytic activity, is required for interaction with Complex I, as demonstrated by the fact that mutation in the ATPase domain was compensated for by a proteolytically inactive form of FTSH3 . This suggests experimental designs should focus on separating the unfoldase activity from proteolytic function.

What are the major challenges in studying membrane-bound proteases like FTSH3?

Membrane-bound proteases like FTSH3 present unique experimental challenges that require specialized approaches. Major challenges include:

  • Protein solubilization and stability:

    • FTSH3 is an inner membrane-bound AAA+ protease

    • Maintaining native conformation requires careful detergent selection

    • Solution: Use mild detergents (DDM, LMNG) or nanodisc/amphipol technologies

  • Functional reconstitution:

    • Ensuring proper membrane orientation and oligomeric state

    • Preserving both ATPase and proteolytic activities after purification

    • Solution: Liposome reconstitution with defined lipid composition mimicking mitochondrial inner membrane

  • Substrate specificity determination:

    • Identifying natural substrates beyond known interactions (e.g., PSST)

    • Distinguishing direct from indirect effects

    • Solution: Proximity labeling methods (BioID, APEX) combined with quantitative proteomics

  • Structural analysis limitations:

    • Membrane proteins are challenging for crystallization

    • Dynamic nature of AAA+ proteins adds complexity

    • Solution: Cryo-EM for near-native structure; crosslinking mass spectrometry for interaction interfaces

For researchers addressing these challenges, it's advisable to:

  • Begin with truncated constructs containing soluble domains

  • Progress to full-length protein with optimized detergent conditions

  • Validate function at each step through activity assays

  • Consider native-MS approaches to verify oligomeric states

How can contradictory data regarding FTSH3 function be reconciled through experimental design?

Resolving contradictory findings about FTSH3 function requires careful experimental design and consideration of context-dependent effects:

  • Common sources of contradictory data:

    • Different experimental systems (in vitro vs. in vivo)

    • Varying stress conditions or developmental stages

    • Overlapping functions with other proteases

    • Model species differences (Arabidopsis vs. rice)

  • Reconciliation strategies:

    ApproachMethodologyAdvantage
    Genetic complementationCross-species expressionTests functional conservation
    Domain swappingChimeric proteinsMaps functional domains
    Condition-specific analysisVarying stress treatmentsReveals context-dependent roles
    Protease inhibitor profilesSelective inhibitionDistinguishes protease contributions
  • Specific contradictions to address:

    • ATPase vs. proteolytic activity importance: The finding that the ATPase function of FTSH3, rather than its proteolytic activity, is required for interaction with Complex I challenges conventional views of FTSH3 function

    • Solution: Create separation-of-function mutants affecting only ATPase or only proteolytic activity

  • Unbiased experimental design principles:

    • Include positive and negative controls in all experiments

    • Perform experiments in multiple genetic backgrounds

    • Use complementary methods for key findings

    • Consider tissue-specific and developmental timing effects

A particularly useful approach is to design experiments that can directly test competing hypotheses. For example, if contradictory findings suggest FTSH3 either degrades Complex I directly or facilitates its disassembly for degradation by other proteases, design an experiment that can specifically detect partially disassembled intermediates in various protease mutant backgrounds.

What methodological approaches can resolve the specificity of FTSH3 for different respiratory chain complexes?

Determining the substrate specificity of FTSH3 across different respiratory chain complexes requires multifaceted approaches:

  • Comparative stability analysis:

    • Monitor turnover rates of all respiratory complexes in wild-type vs. FTSH3 mutants

    • Use pulse-chase experiments with radiolabeled amino acids

    • Measure half-lives of individual subunits via quantitative proteomics

    • Assess complex integrity through blue native PAGE analysis

  • Direct interaction mapping:

    TechniqueApplicationResolution level
    Crosslinking-MSMaps interaction interfacesAmino acid-level
    Co-IP followed by MSIdentifies stable interactionsProtein-level
    Proximity labelingDetects transient interactionsNeighborhood-level
    Hydrogen-deuterium exchangeReveals structural changesDomain-level
  • In vitro degradation/disassembly assays:

    • Purify individual respiratory complexes

    • Expose to recombinant FTSH3 with ATP

    • Monitor disassembly and degradation kinetics

    • Compare susceptibility across complexes

  • Structural determinants of recognition:

    • Perform systematic mutagenesis of potential recognition motifs

    • Create chimeric proteins between susceptible and resistant subunits

    • Use computational prediction of disorder and degron sequences

    • Validate predictions through targeted mutations

What are the promising areas for future research on FTSH3 function in crop species?

Several promising research directions could advance our understanding of FTSH3 function in rice and other crop species:

  • Agricultural applications:

    • Exploring FTSH3 variants for enhanced stress tolerance in crops

    • Investigating links between FTSH3 function and cytoplasmic male sterility in hybrid rice production

    • Examining the role of FTSH3 in seed germination and vigor

  • Comparative studies across cultivars:

    • Analyzing natural variation in FTSH3 across rice varieties

    • Correlating sequence polymorphisms with stress tolerance

    • Investigating adaptation of FTSH3 function in upland vs. lowland rice

  • Regulatory networks:

    • Mapping transcriptional and post-translational regulation of FTSH3

    • Identifying environmental signals that modulate FTSH3 activity

    • Uncovering feedback mechanisms between respiratory efficiency and FTSH3 expression

  • Integration with other quality control systems:

    • Exploring coordination between FTSH3 and other mitochondrial proteases

    • Investigating cross-talk between mitochondrial and chloroplast protein quality control

    • Examining links to mitophagy and whole-organelle turnover

The finding that FTSH3 facilitates the disassembly of Complex I through interaction with the PSST subunit opens avenues for engineering respiratory efficiency in crops, potentially impacting stress tolerance and yield under challenging environmental conditions.

How might researchers develop tools for studying FTSH3 activity in living cells?

Developing tools to study FTSH3 activity in living cells would significantly advance our understanding of its dynamic functions:

  • Fluorescent reporter systems:

    • Design FRET-based sensors that respond to FTSH3 activity

    • Create destabilized fluorescent proteins with FTSH3-specific degrons

    • Develop split fluorescent proteins that assemble upon FTSH3-mediated proteolysis

  • Live-cell imaging approaches:

    ApproachApplicationAdvantage
    FTSH3-fluorescent protein fusionsLocalization dynamicsTracks enzyme distribution
    Substrate-GFP fusionsTurnover visualizationMonitors degradation in real-time
    Photoactivatable substratesPulse-chase in vivoFollows specific substrate cohorts
    FLIM-FRETProtein-protein interactionsDetects nanoscale proximity
  • Activity-based probes:

    • Develop chemical probes that covalently bind active FTSH3

    • Design quenched fluorescent peptides activated by FTSH3 proteolysis

    • Create biotinylated inhibitors for activity-dependent pulldowns

  • Genetic sensors:

    • Establish conditional reporter systems that respond to FTSH3 deficiency

    • Develop transcriptional reporters for FTSH3-regulated genes

    • Create synthetic genetic circuits that amplify FTSH3 activity signals

  • Optogenetic approaches:

    • Design light-inducible FTSH3 activation systems

    • Create optogenetic tools to recruit FTSH3 to specific substrates

    • Develop photoswitchable inhibitors for precise temporal control

These tools would enable researchers to address key questions about FTSH3 activity: How does it respond to different stress conditions? What is the spatial distribution of FTSH3 activity within mitochondria? How is its activity coordinated with other quality control systems?

What structural biology approaches could reveal the mechanism of FTSH3-mediated Complex I disassembly?

Structural biology approaches offer powerful tools to elucidate the mechanism of FTSH3-mediated Complex I disassembly at molecular resolution:

Since FTSH3's ATPase function, rather than its proteolytic activity, is required for interaction with Complex I , structural studies should focus on how ATP binding and hydrolysis drive conformational changes that facilitate Complex I disassembly. Understanding this mechanism at atomic resolution could reveal fundamental principles of protein quality control applicable across diverse biological systems.

What are the best protocols for analyzing FTSH3 expression and activity in plant tissues?

Comprehensive analysis of FTSH3 expression and activity requires multiple complementary approaches:

  • Transcript level analysis:

    • RT-qPCR using gene-specific primers

    • RNA-seq for genome-wide expression context

    • 5' RACE to identify transcription start sites and potential alternative transcripts

    • Northern blotting for transcript size verification

  • Protein level detection:

    TechniqueApplicationConsiderations
    Western blottingProtein abundanceRequires specific antibodies
    ImmunoprecipitationProtein interactionsPreserves native complexes
    Mass spectrometryAbsolute quantificationUse isotope-labeled standards
    BN-PAGENative complex analysisMaintains oligomeric structures
  • Activity assays:

    • ATPase activity: measure phosphate release using malachite green

    • Proteolytic activity: fluorogenic peptide substrates

    • Substrate processing: monitor Complex I subunit turnover

    • In-gel activity assays for native gel separations

  • Tissue-specific analysis:

    • Laser capture microdissection for cell-type specific samples

    • GUS reporter fusions for promoter activity mapping

    • Fluorescent protein fusions for protein localization

    • Immunohistochemistry for tissue sections

For optimal results, researchers should:

  • Include appropriate controls (tissue types, developmental stages)

  • Normalize expression against stable reference genes

  • Compare results across multiple independent biological replicates

  • Consider diurnal fluctuations in expression and activity

Based on previous mitochondrial proteome studies, expect potential heterogeneity in FTSH3 expression across rice tissues, with possible enhanced expression in photosynthetic tissues .

How can researchers generate and characterize functional FTSH3 mutants?

Generating and characterizing functional FTSH3 mutants requires strategic approaches to ensure specific alterations while maintaining protein expression:

  • Mutant generation strategies:

    ApproachAdvantagesLimitations
    CRISPR/Cas9Precise editingPotential off-targets
    TILLINGNon-GMO statusLimited to point mutations
    RNAiPartial knockdownVariable suppression
    T-DNA/transposonComplete knockoutMay affect nearby genes
  • Targeted mutations for functional studies:

    • ATPase domain: Walker A (K→A) to abolish ATP binding

    • ATPase domain: Walker B (E→Q) to allow binding but prevent hydrolysis

    • Zinc-binding motif: HEXXH→AEXXQ to eliminate proteolytic activity

    • N-terminal region: mutations affecting membrane insertion

    • PSST-interaction region: mutations disrupting Complex I recognition

  • Physiological characterization:

    • Growth analysis under normal and stress conditions

    • Mitochondrial respiration measurements

    • ROS production and oxidative stress markers

    • Metabolomic profiling for altered mitochondrial metabolism

  • Molecular phenotyping:

    • Respiratory complex abundance and activity

    • Protein turnover rates using pulse-chase experiments

    • Accumulation of oxidatively damaged proteins

    • Compensatory changes in other proteases

The finding that mutations in the ATPase domain of FTSH3 prevent interaction with the PSST subunit of Complex I suggests that careful characterization of separation-of-function mutations could provide valuable insights into the distinct roles of FTSH3's different activities.

For complementation studies, researchers should consider expressing the recombinant FTSH3 protein (residues 22-802) with an N-terminal His tag, as this has been successfully produced in E. coli .

What are the most significant unresolved questions about FTSH3 function in rice mitochondria?

Despite recent advances, several fundamental questions about FTSH3 function in rice mitochondria remain unresolved:

  • Substrate specificity beyond Complex I:

    • Does FTSH3 target other respiratory complexes?

    • What determines substrate recognition beyond the PSST interaction?

    • Are there non-respiratory chain substrates?

  • Regulatory mechanisms:

    • How is FTSH3 activity regulated in response to different stresses?

    • What post-translational modifications affect FTSH3 function?

    • How is FTSH3 expression coordinated with mitochondrial biogenesis?

  • Functional redundancy:

    • What is the division of labor between FTSH3 and its paralog FTSH8?

    • How do multiple mitochondrial proteases coordinate their activities?

    • What compensatory mechanisms exist when FTSH3 is deficient?

  • Evolutionary specialization:

    • Why do rice and Arabidopsis differ in their FtsH gene complement?

    • What selective pressures shaped FTSH3 function in different plant lineages?

    • How does FTSH3 function differ between C3 and C4 plants?

  • Agricultural relevance:

    • How does FTSH3 function contribute to stress tolerance?

    • Is there natural variation in FTSH3 that correlates with agronomic traits?

    • Could FTSH3 manipulation improve crop performance?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.