Recombinant Oryza sativa subsp. japonica ATP-dependent zinc metalloprotease FTSH 9, chloroplastic/mitochondrial (FTSH9)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request; additional fees apply. Please contact us in advance.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, we can prioritize the development of a specified tag if provided during ordering.
Synonyms
FTSH9; Os01g0618800; LOC_Os01g43150; B1040D09.10-1; B1040D09.11; OsJ_002539; ATP-dependent zinc metalloprotease FTSH 9, chloroplastic/mitochondrial; OsFTSH9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
48-784
Protein Length
Full Length of Mature Protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
FTSH9
Target Protein Sequence
LASEGPQPAPSPAPDPPPPELPAAPEAEEVVGTAAAEGGGKVEEEELEDLVEKGRAWVLA LAAAVVAAARRFFDWVVSGDWMSWWPFWRPDRRLQRLIDDADANPADPAKQSALLHELNK FSPEDVIKRFEQRSHAVDSRGVAEYLRALILTNGIADYLPDEQSGRSASLPALLQELKQR VSGNEDKPFMNPGISEKQPLHVVMVDPKATGRSTRFAQEIFSTVLFTIAVGLMWVMGAAA LQKYIGSLGGIGASGVGSSSSYSPKELNKDIMPEKNVKTFKDVKGCDDAKKELEEVVEYL KNPSKFTRLGGKLPKGILLTGSPGTGKTLLAKAIAGEAGVPFFYRAGSEFEEMFVGVGAR RVRSLFQAAKKKAPCIVFIDEIDAVGSTRKQWEGHTKKTLHQLLVEMDGFEQNEGIIVMA ATNLPDILDPALTRPGRFDRHIVVPNPDVRGRQEILELYLQDKPVSSDVDVNAIARSTPG FNGADLANLVNIAAIKAAVEGADKLAAAQLEFAKDRIIMGTERKSMFISDESKKACLFKL LYFILRELILTAYHESGHAIVALNTQGAHPIHKATILPRGSALGMVTQLPSQDETSISKK QLLARLDVCMGGRVAEELIFGEDNVTTGARNDLHTATELAQYMVSNCGMSDAIGPVHVKE RPSVEMQSRIDAEVVKLLREAYGRVKRLLKKHEKQLHALANALLERETLTADEINKVVHP YQEEPQLSFQEEDFALT
Uniprot No.

Target Background

Function
This protein is a putative ATP-dependent zinc metallopeptidase.
Database Links

STRING: 39947.LOC_Os01g43150.1

UniGene: Os.51057

Protein Families
AAA ATPase family; Peptidase M41 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein. Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is ATP-dependent zinc metalloprotease FTSH 9 in Oryza sativa and what is its significance?

ATP-dependent zinc metalloprotease FTSH 9 (FTSH9) is a member of the FtsH protein family in rice (Oryza sativa). The FtsH family consists of ATP-dependent metalloproteases that are essential for plant growth, development, and stress responses . FTSH9 in rice is a dual-targeted protein, localized to both chloroplasts and mitochondria, as indicated by its full name.

FTSH9 significance lies in its proteolytic function, which contributes to protein quality control in these organelles. These proteases act as processive, ATP-dependent zinc metallopeptidases that help maintain organellar homeostasis by degrading damaged or misfolded proteins . The dual localization suggests FTSH9 may coordinate protein quality control across both chloroplasts and mitochondria.

How is the FTSH gene family structured in rice compared to other plant species?

While specific data on the complete FTSH gene family in rice is limited in the provided sources, comparative analysis with other plants shows consistent patterns:

Plant SpeciesNumber of FTSH GenesKey FeaturesSource
Wheat (Triticum aestivum)11 TaFtsH genesUneven chromosomal distribution, varying intron numbers
Tobacco (Nicotiana tabacum)Multiple FtsH genesInvolved in thylakoid membrane maintenance
ArabidopsisMultiple FtsH genesWell-characterized, including chloroplastic FtsHs
Rice (Oryza sativa)Referenced but not enumeratedIncludes psf mutant with alterations in D1 protein turnover

The FTSH gene family in plants is typically classified into eight groups, each characterized by similar structures and conserved motifs . Rice FTSH genes would be expected to follow similar classification patterns, with FTSH9 belonging to a specific group based on its sequence similarity and functional characteristics.

What cellular processes is FTSH9 involved in within Oryza sativa?

Based on research on FtsH proteins in plants, FTSH9 in rice is likely involved in several critical cellular processes:

  • Protein quality control: Degradation of damaged, misfolded, or unnecessary proteins in chloroplasts and mitochondria .

  • Photosystem maintenance: FtsH proteins in plants are crucial for the degradation of the D1 protein during photosystem II repair cycles, especially under light stress conditions . In rice, alterations in D1 protein turnover and PSII repair cycles have been documented in psf mutants .

  • Stress responses: FtsH proteins show differential expression under various stress conditions, suggesting FTSH9 may play roles in rice's response to environmental stresses .

  • Organellar development: FtsH proteins contribute to chloroplast biogenesis and proper development of thylakoid membranes .

What are the optimal methods for isolating and purifying recombinant FTSH9 from Oryza sativa?

The isolation and purification of recombinant FTSH9 from rice requires specialized techniques suitable for membrane-bound metalloproteases:

Expression System Selection:

  • Prokaryotic systems (E. coli): Cost-effective but may have limitations for post-translational modifications

  • Eukaryotic systems (yeast, insect cells): Better for complex proteins with post-translational modifications

  • Plant-based expression systems: Rice protoplast transient expression system can be particularly valuable for expressing rice proteins in their native cellular environment

Purification Protocol:

  • Cell lysis using buffers containing detergents suitable for membrane proteins

  • Affinity chromatography using histidine or other fusion tags

  • Size exclusion chromatography for further purification

  • Assessment of protein activity using zinc-dependent protease assays

For rice proteins specifically, the established rice protoplast system mentioned in source provides an efficient approach for protein expression, which has been used in many laboratories for protein expression, subcellular localization, bimolecular fluorescence complementation, and co-immunoprecipitation assays .

How can researchers effectively study FTSH9 function using gene silencing approaches?

Based on methodologies used for studying other FtsH proteins, several approaches can be employed:

BSMV-VIGS Technology:
Barley stripe mosaic virus-induced gene silencing (BSMV-VIGS) has been successfully used to study FtsH gene function in wheat . This technique can be adapted for rice to examine FTSH9 function:

  • Design gene-specific silencing constructs targeting unique regions of FTSH9

  • Introduce the construct using BSMV vectors

  • Assess phenotypic changes and stress responses

  • Confirm silencing efficiency through qRT-PCR

The effectiveness of this approach is demonstrated by research on TaFtsH-1 in wheat, where silencing enhanced wheat's resistance to cadmium toxicity .

CRISPR-Cas9 Gene Editing:
For more permanent genetic modifications, CRISPR-Cas9 can be used to create knockout or knockdown mutants of FTSH9 in rice:

  • Design sgRNAs targeting FTSH9 exons

  • Transform rice using Agrobacterium-mediated transformation

  • Screen transformants for mutations in the FTSH9 gene

  • Characterize homozygous mutant lines for phenotypic changes

What protocols are recommended for studying FTSH9 localization in rice cells?

Given the dual targeting of FTSH9 to chloroplasts and mitochondria, accurate localization studies are crucial:

Fluorescent Protein Fusion:

  • Generate constructs expressing FTSH9 fused to fluorescent proteins (GFP, YFP, etc.)

  • Transform rice protoplasts using established protocols

  • Visualize using confocal microscopy

  • Co-localize with established chloroplast and mitochondrial markers

Immunolocalization:

  • Generate specific antibodies against FTSH9

  • Prepare rice tissue sections or isolated organelles

  • Perform immunogold labeling for electron microscopy or immunofluorescence for light microscopy

  • Quantify relative distribution between chloroplasts and mitochondria

The rice protoplast system described in source is particularly useful for these localization studies as it allows for rapid and efficient expression analysis in vivo.

How does FTSH9 expression in rice respond to different environmental stresses?

Based on studies of FtsH genes in other plants, FTSH9 expression in rice likely shows specific patterns under stress conditions:

Stress TypeExpected Response of FTSH9Rationale Based on FtsH Research
Heavy metal stressDifferential expression patterns depending on metal typeTaFtsH genes showed varied expression under CdCl₂, ZnSO₄, and MnSO₄ stress
Light stressPotential upregulationFtsH proteins are involved in D1 protein degradation under light stress
Submergence stressPossible involvementRice has adaptation mechanisms for hypoxic conditions
Temperature stressLikely responsiveFtsH proteins contribute to stress tolerance in plants

Research on TaFtsH genes in wheat showed that different family members responded differently to various heavy metal stresses. For instance, TaFtsH-6 and TaFtsH-9 initially increased and then decreased under both CdCl₂ and MnSO₄ stress, but gradually increased under ZnSO₄ stress .

For rice specifically, the analysis of native landraces has revealed considerable genetic diversity in stress response mechanisms , suggesting potential variation in FTSH9 expression patterns across different rice varieties and landraces.

What are the structural and functional relationships between FTSH9 and other FTSH family members in rice?

The structural and functional relationships between FTSH proteins are characterized by both conservation and specialization:

Structural Characteristics:

  • FtsH proteins typically contain an ATPase domain (AAA+ family) and a zinc metalloprotease domain

  • They may contain transmembrane domains for membrane anchoring

  • Some FTSH proteins contain an FtsH_ext structural domain at the N-terminus, potentially indicating functional modifications

Evolutionary Relationships:
FtsH genes in plants can be classified into eight clusters, with members within the same cluster showing high sequence homology and similar structural features . This classification is consistent across multiple plant species including Arabidopsis, soybean, and pears .

Functional Specialization:
Different FTSH family members likely have specialized roles while maintaining some functional redundancy. For example, in Arabidopsis, certain FtsH proteins form heteromeric complexes that together contribute to chloroplast biogenesis and repair .

How can researchers identify and characterize the substrates of FTSH9 in rice?

Identifying FTSH9 substrates requires targeted proteomics approaches:

Co-immunoprecipitation (Co-IP) and Mass Spectrometry:

  • Express tagged FTSH9 in rice protoplasts

  • Perform Co-IP to pull down FTSH9 along with bound substrates

  • Analyze purified complexes using mass spectrometry

  • Validate candidate interactions through repeated experiments

Substrate Trapping Approach:

  • Generate proteolytically inactive FTSH9 mutants (e.g., by mutating the zinc-binding domain)

  • Express these mutants in rice cells

  • Identify proteins that bind but are not degraded

  • Confirm with in vitro degradation assays using purified components

Comparative Proteomics:

  • Compare protein profiles between wildtype and FTSH9-deficient rice plants

  • Identify proteins that accumulate in the absence of FTSH9

  • Validate candidates through direct degradation assays

How can understanding FTSH9 function contribute to improving rice stress tolerance?

Research on the FtsH gene family suggests several applications for crop improvement:

Heavy Metal Tolerance:
Studies in wheat demonstrated that silencing TaFtsH-1 enhanced resistance to cadmium toxicity . Similar approaches targeting FTSH9 in rice could potentially improve tolerance to heavy metal-contaminated soils.

Climate Resilience:
As climate change intensifies, rice crops face increased abiotic stressors. Understanding how FTSH9 contributes to stress responses could lead to varieties with enhanced tolerance to temperature fluctuations, flooding, and drought .

Native rice landraces represent an untapped genetic resource for abiotic stress-tolerant traits . Analysis of FTSH9 variants in these landraces could identify naturally occurring beneficial alleles that could be introduced into commercial rice varieties.

What innovative research models are emerging for studying FTSH proteins in rice?

Rice Protoplast Systems:
The established rice protoplast system provides a rapid and efficient approach for protein expression and analysis in vivo . This system is particularly valuable for:

  • Transient expression analysis

  • Protein localization studies

  • Bimolecular fluorescence complementation

  • Co-immunoprecipitation assays

Genomic Resources:
The availability of diverse rice genomic resources enhances research capabilities:

  • The completed rice genome sequence allows for comprehensive identification of all FTSH family members

  • Global genomic diversity studies of O. sativa varieties provide insights into variation in FTSH genes across rice populations

  • Comparative genomics approaches using multiple Oryza species can reveal evolutionary patterns

Weedy Rice as a Genetic Resource:
Weedy rice (Oryza sativa ssp.) represents an untapped genetic resource with increased genetic variability and inherent tolerance to abiotic stressors . These weedy relatives could provide novel FTSH9 alleles with enhanced functionality under stress conditions.

What are the challenges and potential solutions in working with recombinant FTSH9 protein?

Challenges in Working with FTSH9:

  • Membrane association: As a membrane-bound protein, FTSH9 presents challenges for solubilization and purification while maintaining native structure and activity.

  • Dual targeting: The dual localization to chloroplasts and mitochondria complicates the interpretation of functional studies.

  • Functional redundancy: Potential redundancy with other FTSH family members may mask phenotypes in single-gene studies.

Methodological Solutions:

  • For membrane protein challenges:

    • Use specialized detergents optimized for chloroplast/mitochondrial membrane proteins

    • Consider nanodiscs or other membrane mimetics for maintaining native structure

    • Express soluble domains separately for structural studies

  • For localization specificity:

    • Design constructs with modified targeting sequences to direct expression exclusively to either chloroplasts or mitochondria

    • Use organelle-specific inhibitors to dissect function in each compartment

  • For functional redundancy:

    • Employ multiplex gene editing to target multiple FTSH genes simultaneously

    • Use conditional expression systems to overcome potential lethality of multiple knockouts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.