Recombinant Oryza sativa subsp. japonica ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Introduction to ATP Synthase and Subunit a (atpI)

ATP synthase is a critical enzyme in chloroplasts responsible for synthesizing ATP during photosynthesis by harnessing the proton gradient across thylakoid membranes. The enzyme comprises two main domains: the F₁ domain (catalytic) and the F₀ domain (proton translocation). The F₀ sector includes subunit a (atpI), a hydrophobic transmembrane protein essential for integrating the rotor subunits (e.g., c-ring) and stabilizing the ATP synthase complex .

In Oryza sativa (rice), the recombinant ATP synthase subunit a (atpI) is a chloroplast-encoded protein (UniProt ID: P0C2Y5) spanning 247 amino acids. Recombinant versions are produced to study its structural and functional roles in ATP synthase assembly and proton-coupled ATP synthesis .

Protein Structure and Sequence Features

Subunit a (atpI) is a core component of the F₀ domain, forming part of the peripheral stalk that connects the F₁ and F₀ subunits. Key structural attributes include:

FeatureDetailsSource
Sequence Length247 amino acids (1–247 aa)
Post-Translational ModificationsN-terminal truncation (common in chloroplast ATP synthase subunits)
Membrane TopologyHydrophobic transmembrane helices facilitating proton channel formation

The recombinant protein is often expressed with an N-terminal His-tag (e.g., in E. coli) to facilitate purification and biochemical studies .

Recombinant Production and Expression Systems

Recombinant atpI is typically produced in E. coli due to its robust expression systems and cost-effectiveness. Key parameters include:

ParameterDetailsSource
Host StrainE. coli BL21(DE3) or K12 (e.g., TG1)
TagN-terminal His-tag (6xHis)
Purity≥85% (SDS-PAGE confirmed)

During production, E. coli strains often experience metabolic burden, characterized by ATP accumulation and excess precursor metabolites (e.g., fructose-1,6-bisphosphate, pyruvate). This occurs due to constraints in anabolic pathways rather than energy limitation .

Applications in Research and Biotechnology

Recombinant atpI serves as a tool for:

  1. Structural Studies: Investigating F₀-F₁ interactions and proton channel dynamics .

  2. Disease Resistance: While not directly linked to atpI, ATP-binding cassette (ABC) transporters in rice (e.g., OsABC9) are implicated in sheath blight resistance, highlighting broader ATP synthase-related pathways in stress responses .

  3. Protein Engineering: Optimizing expression systems to mitigate metabolic burden in E. coli .

Challenges and Future Directions

Key gaps include:

  • Species-Specific Roles: Limited studies on Oryza sativa atpI compared to bacterial or algal homologs.

  • Functional Specialization: Potential redundancy with other chaperones (e.g., YidC-like proteins) in ATP synthase assembly .

Future research should focus on crystallographic studies of atpI and its interactions with peripheral stalk subunits to elucidate its mechanistic role in plants .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific requirement for the format, please indicate it in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
atpI; LOC_Osp1g00280; Nip041; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
atpI
Target Protein Sequence
MNIIPCSIKTLKGLYDISGVEVGQHFYWQIGGFQIHAQVLITSWVVITILLGSVIIAVRN PQTIPTDGQNFFEYVLEFIRDLSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSAAYFYAGLSKKGLSYFEKYIKPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
A crucial component of the proton channel, this protein plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of ATP synthase subunit a (atpI) in rice chloroplasts?

ATP synthase subunit a (atpI) is a critical component of the chloroplastic ATP synthase complex in Oryza sativa. This protein participates in the FO portion of the ATP synthase, which spans the thylakoid membrane and forms the proton channel. The atpI subunit works in conjunction with other components to facilitate proton movement across the thylakoid membrane, utilizing the proton motive force generated by light-driven electron transport reactions to drive ATP synthesis . This process is fundamental to photosynthetic energy conversion, where the ATP produced serves as the universal cellular energy cofactor that fuels various metabolic processes in rice plants .

How does chloroplastic atpI differ from mitochondrial ATP synthase components in rice?

The chloroplastic ATP synthase subunit a (atpI) and mitochondrial ATP synthase components in rice exhibit several key differences in terms of genomic origin, structure, regulation, and functional context:

  • Genomic encoding: The chloroplastic atpI is encoded by the chloroplast genome, whereas many mitochondrial ATP synthase components like RMtATP6 (a 6 kDa subunit) are nuclear-encoded despite functioning in mitochondria .

  • Physical properties: Mitochondrial components like RMtATP6 have distinctive properties - for instance, RMtATP6 has a molecular weight of approximately 6 kDa and a predicted pI of 10.01 . The chloroplastic atpI typically has different molecular characteristics.

  • Functional context: While both participate in ATP synthesis, the chloroplastic atpI functions specifically in the photosynthetic electron transport system, utilizing light energy captured by photosystems. In contrast, mitochondrial ATP synthase components like those in the mitochondrial carrier family operate within the respiratory electron transport chain .

  • Regulatory mechanisms: The expression and activity of these components respond differently to environmental cues. For example, mitochondrial carrier proteins show significant changes during anaerobic and aerobic germination in rice , while chloroplastic ATP synthase components are more responsive to light conditions and photosynthetic demands .

What expression systems are suitable for producing recombinant atpI protein?

Based on successful approaches with related ATP synthase components in rice, several expression systems can be adapted for recombinant atpI production:

Expression SystemAdvantagesChallengesNotable Features
E. coli (pGEX vector system)Rapid growth, high yield, economic productionPotential folding issues with membrane proteinsEffective for ATP synthase components; yields ~4.6 mg/L of bacterial culture with related proteins
Plant-based expression (rice/tobacco)Native post-translational modifications, proper membrane integrationLower yields, longer production timeBetter folding of plant membrane proteins; allows functional studies in planta
Yeast expression systemsEukaryotic processing, membrane protein handlingMedium complexity, moderate yieldsCompromise between bacterial yield and plant authenticity
Cell-free systemsAvoids toxicity issues, allows direct labelingHigher cost, technical complexityEnables production of potentially toxic membrane proteins

For chloroplastic atpI specifically, the E. coli expression system using the pGEX vector (or similar) offers an efficient starting point, as demonstrated with the rice mitochondrial ATP synthase subunit . This system would involve cloning the atpI gene into a GST-fusion vector, expressing the fusion protein, and purifying it via affinity chromatography. The GST tag can subsequently be removed via enzymatic cleavage to obtain the purified recombinant atpI protein .

What are the optimal conditions for expressing recombinant rice atpI in E. coli?

Based on comparable studies with rice ATP synthase components, the following optimized protocol is recommended for recombinant atpI expression:

  • Vector selection: A pGEX-6p-3 or similar vector system that allows expression of atpI as a glutathione S-transferase (GST) fusion protein is recommended . This approach facilitates both solubility enhancement and simplified purification.

  • E. coli strain selection: BL21(DE3) or Rosetta strains are preferred due to their reduced protease activity and enhanced expression capabilities for plant proteins .

  • Culture conditions:

    • Initial growth at 37°C to OD₆₀₀ of 0.6-0.8

    • Temperature reduction to 18-20°C prior to induction (critical for membrane protein folding)

    • IPTG concentration: 0.1-0.3 mM (lower concentrations favor proper folding)

    • Post-induction incubation: 16-18 hours at 18-20°C with moderate shaking (180 rpm)

  • Media composition: Enriched media such as Terrific Broth supplemented with glucose (0.4%) improves biomass and reduces basal expression before induction .

  • Critical parameters for optimization:

    • IPTG concentration

    • Induction temperature

    • Expression duration

    • Cell density at induction

This approach has yielded approximately 4.6 mg of purified protein per liter of bacterial culture for similar rice ATP synthase components , providing a benchmark for atpI production efficiency.

What purification strategies are most effective for obtaining high-purity recombinant atpI?

A multi-step purification strategy is recommended to achieve high-purity recombinant atpI protein:

  • Initial affinity chromatography: Using a glutathione-Sepharose 4B column to capture the GST-fusion protein . Binding should be performed at 4°C with a flow rate of 0.5-1 ml/min, followed by extensive washing with PBS containing 1% Triton X-100 to remove membrane lipids.

  • On-column cleavage: Applying PreScission protease directly to the column to cleave the GST tag while the fusion protein remains bound. This approach simplifies separation of the tag from the target protein .

  • Secondary purification: Implementing size exclusion chromatography using a Superdex 75 column to remove aggregates and further purify the atpI protein.

  • Optional ion exchange step: Given the typically basic pI of ATP synthase components (for example, RMtATP6 has a pI of 10.01) , a cation exchange chromatography step using SP-Sepharose might improve purity.

  • Detergent considerations: Throughout purification, a mild detergent (0.1% n-Dodecyl β-D-maltoside) should be maintained to prevent aggregation of this membrane protein.

Western blot analysis using antibodies against atpI or the GST tag should be performed to verify the integrity of the purified protein and ensure the fusion protein remains intact until deliberate cleavage . Successful purification should yield a single band of approximately the expected molecular weight for atpI on SDS-PAGE.

How can researchers verify the functional integrity of purified recombinant atpI?

Multiple complementary approaches can be employed to verify the functional integrity of purified recombinant atpI:

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure characteristics

    • Limited proteolysis patterns compared to native protein

    • Thermal shift assays to evaluate protein stability

  • Membrane incorporation assays:

    • Reconstitution into liposomes and evaluation of integration efficiency

    • Proton conductance measurements in proteoliposomes

  • Complex assembly verification:

    • Blue Native-PAGE to assess incorporation into ATP synthase complexes when combined with other subunits

    • Co-immunoprecipitation with known interacting partners from the ATP synthase complex

  • Functional assays:

    • Proton conductivity measurements of reconstituted membranes containing atpI

    • ATP synthesis activity when incorporated with other ATP synthase components

    • Proton/ATP ratio determination in reconstituted systems

  • In vivo complementation:

    • Introduction into atpI-deficient systems to assess functional rescue

    • Measurement of electron transport rates and ATP synthesis in complemented systems

Researchers working with chloroplast ATP synthase have successfully employed Blue Native-PAGE coupled with immunodetection and proton conductivity measurements to verify the functional incorporation and activity of ATP synthase components in rice , suggesting these approaches would be applicable to recombinant atpI validation.

What technological approaches are most effective for studying protein-protein interactions involving atpI?

Several cutting-edge approaches are particularly effective for investigating protein-protein interactions involving membrane proteins like atpI:

  • Proximity-based labeling techniques:

    • BioID or TurboID fusion constructs with atpI to identify proximal proteins in vivo

    • APEX2-based proximity labeling for millisecond-scale interaction detection

    • These methods are advantageous for membrane proteins as they don't require stable interactions

  • Cryo-EM structural analysis:

    • Single-particle analysis of purified ATP synthase complexes containing atpI

    • Subtomogram averaging of membrane-embedded complexes

    • These approaches have revolutionized structural studies of membrane protein complexes

  • Advanced microscopy techniques:

    • Förster Resonance Energy Transfer (FRET) between fluorescently labeled ATP synthase components

    • Fluorescence Lifetime Imaging Microscopy (FLIM) to detect interactions in vivo

    • Single-molecule tracking to observe dynamic associations

  • Crosslinking mass spectrometry (XL-MS):

    • Chemical crosslinking of intact chloroplasts followed by mass spectrometry

    • Identification of residue-specific interactions between atpI and other subunits

    • This approach has been successfully applied to membrane protein complexes in chloroplasts

  • Blue Native-PAGE coupled with second-dimension separation:

    • Effective for analyzing intact membrane protein complexes and identifying components

    • Successfully applied to ATP synthase complexes in rice

    • Can be combined with mass spectrometry for comprehensive subunit identification

For chloroplast membrane proteins like atpI, these approaches should be complemented with appropriate membrane-mimetic environments throughout sample preparation to maintain native-like interactions.

How do environmental stresses affect atpI expression and ATP synthase function in rice?

Environmental stresses significantly impact ATP synthase component expression and function in rice, with implications for atpI:

  • Drought stress effects:

    • Altered expression patterns of energy metabolism genes

    • Drought-tolerant rice lines show maintenance of ATP synthase function under water limitation

    • Heterologous expression studies in rice demonstrate that stress-response pathways can modulate energy production components

  • Salt stress impacts:

    • Salt stress triggers differential expression of 2130 genes in transgenically-modified rice

    • Energy production pathways, including those involving ATP synthase, show altered regulation

    • Maintenance of chlorophyll content and reduced membrane damage (lower MDA content) correlate with sustained ATP synthase function

  • Temperature stress responses:

    • Heat stress may alter the expression of ATP synthase components

    • Cold stress typically downregulates energy metabolism genes

  • Regulatory mechanisms:

    • Stress response involves complex signaling pathways including plant hormone signaling and phosphoinositol pathways

    • These pathways potentially regulate ATP synthase component expression and activity

  • Adaptive significance:

    • Maintenance of ATP synthase function under stress conditions preserves energy production

    • This energy availability supports stress response mechanisms and cellular homeostasis

While the specific regulatory mechanisms controlling atpI expression under stress conditions remain to be fully elucidated, the general pattern suggests coordinated regulation of energy production components, including ATP synthase, as part of the plant's stress response strategy . Stress-tolerant rice varieties likely maintain better ATP synthase function under adverse conditions compared to sensitive varieties.

What are the best approaches for generating atpI knockout or knockdown rice lines?

Several complementary approaches can be employed to generate atpI knockout or knockdown rice lines, each with distinct advantages and considerations:

  • CRISPR/Cas9 genome editing:

    • Target-specific gRNAs designed against the chloroplast-encoded atpI gene

    • Biolistic transformation of rice plastids using gold particles coated with CRISPR/Cas9 components

    • Screening for homoplasmic transformants through repeated selection cycles

    • Advantage: Complete knockout possible; challenge: Plastid transformation is technically demanding

  • Transplastomic approaches:

    • Homologous recombination-based replacement of atpI with a modified version

    • Selection using spectinomycin resistance markers

    • Verification of homoplasmy through PCR and Southern blotting

    • Advantage: Precise modification; challenge: Low efficiency in cereals

  • RNA interference (RNAi):

    • Nuclear transformation with constructs expressing hairpin RNAs targeting atpI transcripts

    • Agrobacterium-mediated transformation similar to methods used for TaPI-PLC1-2B expression

    • Selection of transformants on appropriate antibiotic medium

    • Advantage: Technically simpler than plastid transformation; limitation: Incomplete knockdown

  • Inducible antisense expression:

    • Estradiol or dexamethasone-inducible promoters driving antisense atpI expression

    • Allows temporal control of knockdown to avoid lethality

    • Especially valuable since complete atpI knockout might be lethal

    • Advantage: Controllable expression timing; limitation: Leaky expression possible

  • TALEN-based approaches:

    • Alternative to CRISPR for plastid genome editing

    • Some studies suggest higher efficiency for plastid transformation

    • Similar delivery methods to CRISPR systems

    • Advantage: Potentially higher specificity; limitation: More complex design requirements

Selection of the appropriate method should consider the research objectives, whether complete knockout or partial reduction of function is desired, and the technical capabilities available. Given the essential nature of ATP synthase for photosynthesis, inducible or partial knockdown approaches may be preferable to allow the development of viable plants for study .

What experimental approaches would best reveal the impact of atpI modifications on rice crop performance?

A comprehensive experimental design to assess the impact of atpI modifications on rice crop performance should include:

  • Controlled environment studies:

    • Gas exchange measurements to determine photosynthetic parameters (CO₂ assimilation, electron transport rate, Vcmax)

    • Chlorophyll fluorescence analysis to assess photosystem II efficiency

    • Growth chamber experiments with controlled light, temperature, and CO₂ conditions

    • Detailed biomass partitioning analysis between roots, stems, leaves, and reproductive structures

  • Field trials under multiple conditions:

    • Performance assessment under optimal irrigation vs. drought conditions

    • Comparison of yield components (panicle number, filled grain percentage, 1000-grain weight)

    • Multi-location trials to evaluate genotype × environment interactions

    • Measurement of canopy temperature as an indicator of transpiration efficiency

  • Stress response evaluation:

    • Combined stresses (heat+drought) to mimic climate change scenarios

    • Measurement of MDA content to assess membrane damage under stress

    • Chlorophyll retention analysis during stress exposure

    • Recovery capacity following stress relief

  • Molecular phenotyping:

    • Transcriptome analysis under various conditions to identify differential gene expression

    • Blue Native-PAGE to quantify ATP synthase complex abundance

    • Protein quantification using mass spectrometry approaches

    • Metabolomic profiling to assess impact on primary metabolism

  • Integrative analysis approaches:

    • Correlation of molecular phenotypes with whole-plant performance metrics

    • Path analysis to determine contribution of photosynthetic parameters to yield

    • Machine learning approaches to identify key predictors of performance

    • Crop modeling to predict impact under future climate scenarios

This multi-level experimental approach would enable researchers to link molecular-level modifications of atpI to field-relevant performance metrics, providing both mechanistic understanding and practical insights for crop improvement .

How can researchers effectively study interactions between atpI and other ATP synthase subunits?

To effectively investigate interactions between atpI and other ATP synthase subunits, researchers should employ a multi-technique approach:

  • Structural biology approaches:

    • Cryo-EM of intact ATP synthase complexes to visualize subunit arrangements

    • Mass spectrometry of crosslinked complexes to identify residue-specific interactions

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

    • These approaches preserve native-like arrangements of membrane protein complexes

  • Genetic interaction studies:

    • Suppressor screens to identify compensatory mutations

    • Synthetic genetic array analysis using inducible knockdown lines

    • CRISPR interference combinatorial targeting of multiple subunits

    • These methods reveal functional relationships between subunits

  • Biochemical reconstitution:

    • Sequential addition of purified subunits to assess assembly requirements

    • Activity measurements of partially assembled complexes

    • Detergent solubilization optimization to maintain intact complexes

    • These approaches determine the functional contribution of each subunit

  • In vivo tracking methods:

    • Split fluorescent protein complementation to visualize interactions

    • FRET pairs on adjacent subunits to measure proximity

    • Fluorescence correlation spectroscopy to assess co-diffusion

    • These techniques capture dynamic interactions in living systems

  • Computational approaches:

    • Molecular dynamics simulations of subunit interactions

    • Coevolution analysis to identify co-varying residues

    • Protein-protein docking with experimental constraints

    • These methods generate testable hypotheses about interaction mechanisms

The analysis of ATP synthase complexes using Blue Native-PAGE coupled with immunodetection has been successfully applied in rice , providing a foundation for more detailed interaction studies. For atpI specifically, maintaining appropriate membrane-mimetic environments throughout analysis is critical due to its integral membrane nature.

How might precise engineering of atpI contribute to improving crop photosynthetic efficiency?

Targeted engineering of atpI presents several promising avenues for enhancing photosynthetic efficiency in rice and potentially other crop species:

  • Proton conductance optimization:

    • Strategic mutations in the proton channel-forming regions of atpI

    • Fine-tuning the proton/ATP ratio to optimize energy conversion efficiency

    • Potentially increasing the rate of ATP synthesis under limiting light conditions

    • Research with other ATP synthase components has demonstrated that enhanced proton conductivity correlates with improved photosynthetic performance

  • Regulatory domain modifications:

    • Engineering regulatory interfaces to alter activation/deactivation kinetics

    • Reducing photosynthetic induction time after light transitions

    • Modifying regulatory sites to maintain activity under stress conditions

    • This approach could reduce energy losses during fluctuating light conditions in field environments

  • Thermal stability enhancement:

    • Introduction of stabilizing mutations to improve performance under heat stress

    • Residue substitutions based on thermophilic homologs

    • This strategy could maintain ATP production efficiency under increasingly frequent heat events

  • Redox sensitivity modulation:

    • Altering redox-sensitive regions to maintain activity under varying redox conditions

    • Engineering less sensitive variants for consistent performance across environmental conditions

    • This approach might reduce photosynthetic limitations during drought or other stresses

  • Coordination with complementary approaches:

    • Combining atpI modifications with other ATP synthase component enhancements

    • Coordinated engineering of electron transport components

    • AtpD overexpression has already demonstrated improved photosynthetic performance in rice , suggesting potential for multi-component optimization

The development of chloroplast transformation systems for rice would significantly advance these possibilities, allowing precise modification of the plastid-encoded atpI gene. The enhanced photosynthetic rates observed with ATP synthase modification suggest that engineering the proton channel components, including atpI, could contribute to breaking photosynthetic limitations in crop plants .

What are the challenges and solutions in studying plastid-encoded proteins like atpI?

Studying plastid-encoded proteins like atpI presents several unique challenges along with emerging solutions:

ChallengeDescriptionAdvanced Solutions
Plastid transformationDifficult in cereals including rice; low efficiencyImproved biolistic delivery methods; CRISPR-based plastid editing; alternative delivery vehicles like peptide-based carriers
Homoplasmy achievementNeed to replace all copies of the plastid genomeSequential selection protocols; improved markers; tissue-specific selection systems
Protein expressionMembrane proteins like atpI are challenging to expressCell-free expression systems; optimized detergent screening; lipid nanodisc incorporation
Complex assemblyATP synthase requires multiple subunits for functionCo-expression systems; sequential reconstitution protocols; in vitro translation-coupled systems
Functional analysisRequires membrane environment and proton gradientReconstitution in proteoliposomes; development of chloroplast-mimetic artificial membranes; microfluidic gradient systems
Heteroplasmy effectsMixed wild-type and modified plastid populationsSingle-organelle analysis techniques; improved sorting of transformed plastids; mathematical modeling of heteroplasmic effects

Recent advances in CRISPR technology for organellar genomes and improved plastid transformation protocols are gradually overcoming the transformation barriers . For functional studies, the successful analysis of ATP synthase activity through measurements of proton conductivity in thylakoid membranes offers a valuable approach for assessing atpI mutants . Additionally, developing rice lines with inducible plastid-targeted nucleases could facilitate the study of essential plastid genes like atpI by allowing controlled disruption at specific developmental stages.

How does atpI contribute to the balance between linear and cyclic electron flow in rice photosynthesis?

The ATP synthase complex, of which atpI is a critical component, plays a central role in regulating the balance between linear electron flow (LEF) and cyclic electron flow (CEF) in rice photosynthesis:

  • Mechanistic relationship:

    • ATP synthase activity directly influences thylakoid lumen acidification

    • Lumen pH serves as a key regulatory signal for CEF activation

    • AtpI, as part of the proton channel, influences proton flux and lumen pH

    • Research with ATP synthase components shows that enhanced ATP synthase activity reduces reliance on CEF

  • Energetic balance regulation:

    • The ATP/NADPH production ratio needs precise regulation for optimal carbon fixation

    • ATP synthase activity modulation is a primary mechanism for adjusting this ratio

    • Modified ATP synthase activity through AtpD overexpression has been shown to reduce CEF while enhancing photosynthetic efficiency

    • This suggests atpI modifications could similarly influence ATP/NADPH balancing mechanisms

  • Environmental adaptation roles:

    • Under high light, ATP synthase activity modulation prevents excessive lumen acidification

    • During environmental stress, CEF is typically upregulated to generate additional ATP

    • AtpI potentially serves as a regulatory point in this adaptive response

    • The proton channel characteristics influence how quickly ATP synthase can respond to changing conditions

  • Molecular evidence:

    • Plants with enhanced ATP synthase activity through AtpD overexpression show:

      • Higher electron transport rates at elevated CO₂

      • Reduced CEF

      • Improved CO₂ assimilation

    • These findings suggest that proton channel components, including atpI, are limiting factors in photosynthetic electron transport under certain conditions

  • Significance for crop improvement:

    • Optimizing the LEF/CEF balance could enhance photosynthetic efficiency

    • Strategic atpI modifications might allow fine-tuning of this balance

    • This could be particularly valuable under fluctuating light conditions typical in field environments

Experimental approaches combining measurements of proton conductivity, P700 redox kinetics, and CO₂ assimilation rates would be particularly valuable for elucidating the specific contribution of atpI to this regulatory process .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.