Recombinant Oryza sativa subsp. japonica Bax inhibitor 1 (BI1)

Shipped with Ice Packs
In Stock

Description

Production and Purification

  • Expression: Optimized in E. coli for high yield (purity >90% via SDS-PAGE) .

  • Storage: Lyophilized powder in Tris/PBS buffer with 6% trehalose; stable at -80°C .

Anti-Apoptotic Mechanisms

BI1 inhibits mitochondrial apoptosis by:

  1. Blocking Bax Activation: Prevents mitochondrial outer membrane permeabilization (MOMP) by interacting with pro-apoptotic Bax .

  2. Modulating ER-Mitochondria Crosstalk: Sustains mitochondrial homeostasis via PHB2 import, preserving mtDNA integrity and respiration .

  3. ROS Regulation: Attenuates reactive oxygen species (ROS) accumulation during stress .

Stress Response in Plants

  • Fungal Resistance: Overexpression of BI1 in rice suppresses cell death induced by Magnaporthe grisea (rice blast fungus) .

  • Abiotic Stress: Confers tolerance to heat, drought, and salt stress by stabilizing endoplasmic reticulum (ER) homeostasis .

In Vitro and In Vivo Studies

StudyKey ResultsSource
AKI (Acute Kidney Injury) ModelsBI1 reconstitution reduced mitochondrial fission and apoptosis in renal tubules
Rice Cell CultureBI1 overexpression enhanced survival under fungal elicitor stress
Arabidopsis TransgenicsBI1 interacted with calmodulin (CaM) to regulate Ca²⁺ signaling under stress

Mechanistic Insights

  • PHB2 Interaction: BI1 recruits cytoplasmic PHB2 to mitochondria via TIM23, stabilizing cristae structure and ATP synthesis .

  • ER Stress Modulation: BI1 suppresses IRE1α-mediated ER stress signaling, reducing unfolded protein response (UPR) activation .

Therapeutic Potential

  • Disease Models: BI1 mitigates mitochondrial dysfunction in AKI and myocardial ischemia-reperfusion injury .

  • Drug Development: Recombinant BI1 serves as a tool for screening apoptosis inhibitors .

Agricultural Biotechnology

  • Crop Improvement: Engineered BI1 variants could enhance stress tolerance in rice and other cereals .

  • Pathogen Resistance: BI1 overexpression in transgenic rice reduces susceptibility to fungal pathogens .

Challenges and Future Directions

  • Mechanistic Gaps: The precise role of BI1 in sphingolipid metabolism and ER-mitochondria communication remains unclear .

  • Clinical Translation: BI1’s therapeutic efficacy in humans requires validation in advanced disease models .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot the product for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
BI1; Os02g0125300; LOC_Os02g03280; P0482F12.1-1; P0482F12.1-2; Bax inhibitor 1; BI-1; OsBI-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
BI1
Target Protein Sequence
MDAFYSTSSAYGAAASGWGYDSLKNFRQISPAVQSHLKLVYLTLCVALAASAVGAYLHVA LNIGGMLTMLGCVGSIAWLFSVPVFEERKRFGILLAAALLEGASVGPLIKLAVDFDSSIL VTAFVGTAIAFGCFTCAAIVAKRREYLYLGGLLSSGLSILLWLQFAASIFGHSTGSFMFE VYFGLLIFLGYMVYDTQEIIERAHHGDMDYIKHALTLFTDFVAVLVRILVIMLKNASDKS EEKKRKKRS
Uniprot No.

Target Background

Function
Suppressor of apoptosis.
Database Links

KEGG: osa:4328149

STRING: 39947.LOC_Os02g03280.2

UniGene: Os.6263

Protein Families
BI1 family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitous.

Q&A

What is Bax inhibitor-1 in rice and how was it first identified?

Bax inhibitor-1 (BI-1) in rice (Oryza sativa) is an evolutionarily conserved protein that functions as a suppressor of programmed cell death. It was first isolated from rice (Oryza sativa L.) alongside its Arabidopsis homolog through studies examining genes that suppress cell death induced by mammalian Bax expression in yeast . The rice BI-1 homolog (OsBI-1) shares significant sequence conservation with animal BI-1 proteins, with approximately 45% amino acid similarity, indicating evolutionary conservation of this cell death regulator across kingdoms . Northern blot analysis showed that OsBI-1 transcripts are present in all rice tissues examined, suggesting its fundamental importance in plant cellular processes . Functional analysis demonstrated that the OsBI-1 cDNA could suppress cell death induced by mammalian Bax expression in yeast, confirming its functional role as a cell death suppressor .

What are the structural characteristics of rice BI1 protein?

The rice Bax inhibitor-1 protein contains six to seven membrane-spanning segments that anchor it to cellular membranes, primarily the endoplasmic reticulum (ER) . This transmembrane structure is critical to its function as a cell death regulator. The protein's amino acid sequence shows 45% conservation between plant and animal homologs, indicating strong evolutionary pressure to maintain its structure and function . Similar to other BI-1 proteins, the rice BI-1 likely contains a highly conserved C-terminal domain that is essential for its anti-apoptotic activity. Structural studies suggest that BI-1 creates a channel or pore in the ER membrane that may regulate calcium flux and ER stress responses. The protein's integration into the ER membrane positions it as a key regulator of ER stress-signaling pathways rather than the classical mitochondrial-dependent apoptotic pathway .

How does rice BI1 function in programmed cell death pathways?

Rice BI1 functions primarily as an inhibitor of programmed cell death by interfering with cellular apoptotic pathways. In particular, OsBI-1 suppresses cell death through the endoplasmic reticulum (ER) stress-signaling pathway rather than through the classical mitochondrium-dependent pathway . This is supported by findings that BI-1 deletion reduces resistance to farnesol (an ER stress inducer) but not to hydrogen peroxide (which triggers mitochondrial-dependent death pathways) . The protein appears to regulate calcium homeostasis at the ER, controlling the release of calcium that can trigger downstream cell death processes. At the molecular level, BI-1 acts as a conserved cell death suppressor that can counteract Bax-induced apoptosis, as demonstrated by functional complementation experiments where OsBI-1 cDNA suppressed mammalian Bax-induced cell death in yeast . This conservation of function across diverse organisms highlights the fundamental role of BI-1 in regulating cell death pathways across eukaryotes.

What methods are most effective for cloning and expressing recombinant Oryza sativa BI1?

For effective cloning and expression of recombinant Oryza sativa BI1, researchers should consider a multi-step approach optimized for membrane proteins. First, RNA should be extracted from rice tissues where BI1 is abundantly expressed, followed by RT-PCR using primers designed against the conserved regions of BI1. Based on the published literature, all tissues express OsBI-1, though expression levels may vary . For heterologous expression, bacterial systems like E. coli are suitable for initial studies, but eukaryotic systems such as yeast or insect cells often provide better results for membrane proteins like BI1.

For expression vector selection, the pET system (for bacteria) or pYES2 (for yeast) have been successfully used for similar proteins. When expressing BI1, consider adding purification tags (His6 or GST) to the N-terminus rather than C-terminus, as the C-terminal domain is critical for BI1 function. Expression conditions should be optimized by testing different temperatures (typically 16-30°C), inducer concentrations, and induction times. For membrane proteins like BI1, lower temperatures (16-20°C) often yield better results by allowing proper folding.

Purification protocols should employ detergent solubilization (typically 1% DDM or CHAPS) followed by affinity chromatography and size-exclusion chromatography. Western blotting with anti-BI1 antibodies or tag-specific antibodies should be used to confirm expression and purification success.

What expression patterns does BI1 show across different rice tissues and developmental stages?

Oryza sativa BI1 shows a broad expression pattern across various tissues, with transcripts detected in all tissues examined in Northern blot analysis . This suggests that BI1 plays a fundamental role in rice cellular homeostasis rather than having tissue-specific functions. While BI1 is expressed throughout the plant, expression levels may vary depending on developmental stage and environmental conditions. Studies of wheat BI-1 (a close homolog) have shown tissue-specific expression patterns, with mature leaves and roots showing strong expression while young leaves and hypocotyl tissues showed minimal expression .

The expression of BI1 can be modulated by various plant hormones and stress conditions. For instance, the wheat homolog TaBI-1.1 was upregulated by salicylic acid (SA) treatment but downregulated by abscisic acid (ABA) treatment . Based on these findings in related species, rice BI1 likely shows similar hormone-responsive expression patterns. Additionally, BI1 expression is often induced under various stress conditions, particularly those that trigger endoplasmic reticulum stress responses. This dynamic expression pattern positions BI1 as a critical regulator of stress responses and programmed cell death in rice.

How can researchers design effective knockout or knockdown experiments for rice BI1?

For effective knockout or knockdown of rice BI1, researchers can employ several strategic approaches. CRISPR/Cas9 gene editing represents the most precise method for creating complete knockouts. When designing a CRISPR/Cas9 system for rice BI1, researchers should select target sites in early exons to ensure functional disruption. Multiple gRNAs targeting different exons can increase knockout efficiency, as demonstrated in successful rice genome editing studies . The analysis of knockout efficiency should involve sequencing to confirm mutations, followed by RT-PCR and Western blot analysis to verify the absence of functional transcript and protein.

For knockdown experiments, RNA interference (RNAi) or antisense approaches can be employed when partial reduction of expression is desired. These approaches require careful design of constructs targeting unique regions of BI1 to avoid off-target effects. For transient knockdown studies, virus-induced gene silencing (VIGS) may be employed if suitable viral vectors for rice are available.

When evaluating phenotypes of BI1-modified plants, researchers should examine:

  • Cell death phenotypes under normal and stress conditions

  • Response to pathogen challenge

  • Tolerance to abiotic stresses, particularly those triggering ER stress

  • Morphological development and reproductive capacity

Complementation studies with the wild-type gene should be performed to confirm phenotype specificity. Additionally, researchers should consider potential compensation by related genes, particularly if rice contains multiple BI1 homologs.

How does rice BI1 respond to different abiotic stress conditions?

Rice BI1 shows differential responses to various abiotic stresses, positioning it as a key regulator in stress adaptation pathways. Based on studies of BI1 orthologs in other plant species, rice BI1 likely plays a significant role in mitigating cell death triggered by environmental stresses. In particular, rice BI1 appears to be involved in heat stress responses, as demonstrated in the fungal ortholog MrBI-1, where deletion impaired heat tolerance . This suggests that rice BI1 may similarly protect plants during temperature stress by preventing inappropriate cell death.

Salinity stress represents another significant challenge for rice cultivation, and evidence suggests BI1 may be involved in salinity tolerance mechanisms . Under salinity stress, rice plants exhibit symptoms such as yellowing leaves, tip drying, and chlorosis - processes that may involve programmed cell death pathways where BI1 functions as a regulator. The application of compounds like vitamin B1 has been shown to enhance salinity stress resistance in rice , potentially through pathways that may interact with BI1-mediated cell death regulation.

What is the role of rice BI1 in biotic stress responses and pathogen defense?

Rice BI1 plays a significant role in biotic stress responses and pathogen defense systems. Evidence from studies on wheat BI1 (TaBI-1.1) suggests that plant BI1 proteins are actively involved in defense against pathogens. Constitutive expression of wheat TaBI-1.1 in Arabidopsis enhanced resistance to Pseudomonas syringae pv. Tomato (Pst) DC3000 infection and induced salicylic acid (SA)-related gene expression . This suggests that rice BI1 likely functions in a similar manner, promoting resistance against bacterial pathogens.

The molecular mechanism of BI1-mediated pathogen defense appears to involve positive regulation of SA signaling pathways, which are critical for plant immune responses. This is supported by the observation that TaBI-1.1 expression is induced by SA treatment . Additionally, TaBI-1.1 transgenic Arabidopsis plants showed higher expression of defense-related genes including PCR1, WAK1, LURP1, PR1, LOX2, PRX34, and HR4, which were increased by 4.9-, 3.3-, 2.6-, 7.9-, 33-, 1.7- and 1.7-fold, respectively, compared to wild-type plants .

Rice BI1 may also play a role in defense against viral pathogens. Studies on Rice Yellow Mottle Virus (RYMV) resistance have identified recessive resistance loci that can be modified through genome editing approaches . While direct evidence linking BI1 to RYMV resistance is lacking, the involvement of BI1 in cell death regulation suggests it may contribute to virus-induced cell death responses that limit viral spread.

How do hormonal signaling pathways interact with rice BI1 function?

Rice BI1 function is intricately connected with plant hormonal signaling networks, particularly those involved in stress responses and development. Based on studies of the wheat homolog TaBI-1.1, rice BI1 likely shows differential responses to various plant hormones. Salicylic acid (SA) appears to positively regulate BI1 expression, as TaBI-1.1 expression was induced by SA treatment . This suggests that rice BI1 is part of the SA-mediated defense signaling pathway that activates in response to pathogen attack.

Conversely, abscisic acid (ABA), a hormone primarily associated with abiotic stress responses, seems to negatively regulate BI1 expression. TaBI-1.1 was down-regulated by ABA treatment , indicating a complex interplay between different stress response pathways. This differential response to SA and ABA suggests that rice BI1 may serve as an integration point for biotic and abiotic stress signals.

Transgenic Arabidopsis plants expressing TaBI-1.1 showed decreased sensitivity to ABA, further supporting the antagonistic relationship between BI1 and ABA signaling . Additionally, these transgenic plants exhibited alleviation of damage caused by high concentrations of SA, suggesting that BI1 may help modulate SA toxicity while still promoting SA-mediated defense responses.

The interaction between BI1 and plant hormones represents a sophisticated regulatory network that allows plants to fine-tune their responses to various environmental challenges. This hormonal regulation likely underlies the diverse functions of BI1 in stress adaptation, growth regulation, and pathogen defense in rice.

What are the key protein interaction partners of rice BI1?

Rice BI1 interacts with several key protein partners to execute its cellular functions. One significant interaction partner identified is the aquaporin protein family. In wheat, the BI1 homolog TaBI-1.1 was found to interact with the aquaporin TaPIP1, as demonstrated through yeast two-hybrid and pull-down assays . This interaction takes place on the endoplasmic reticulum (ER) membrane, where both proteins are localized . Given the high conservation of BI1 function across species, rice BI1 likely interacts with similar rice aquaporin proteins, particularly those in the plasma membrane intrinsic protein (PIP) family.

The interaction with aquaporins is particularly significant as these water channel proteins play crucial roles in plant water homeostasis, which is essential for stress responses. This interaction may represent a mechanism by which BI1 influences cellular water balance during stress conditions that might otherwise trigger programmed cell death. Additionally, the co-localization of BI1 and PIPs on the ER membrane suggests that this interaction occurs early in the protein trafficking pathway, potentially influencing the maturation or targeting of aquaporins.

Other potential interaction partners of rice BI1 may include:

  • ER-resident calcium channels, as BI1 is known to regulate calcium homeostasis

  • Components of the unfolded protein response pathway

  • Regulators of the cell death machinery, particularly those localized to the ER

These protein interactions collectively position BI1 as a central hub in stress response networks, particularly those involving ER stress and programmed cell death regulation.

What techniques are most effective for studying rice BI1 protein localization?

Studying rice BI1 protein localization requires a combination of complementary techniques to achieve reliable and comprehensive results. Fluorescent protein fusion approaches represent the gold standard for in vivo localization studies. Researchers should create C-terminal fusions of BI1 with GFP or YFP, as N-terminal fusions may disrupt the protein's membrane insertion. These constructs should be expressed in rice protoplasts or stable transgenic plants under native or constitutive promoters. When imaging, co-localization with established organelle markers is essential - particularly markers for the endoplasmic reticulum (RFP-HDEL or similar), as BI1 is primarily an ER-resident protein .

For biochemical verification, subcellular fractionation followed by western blotting provides complementary evidence of localization. This approach involves isolating different cellular fractions (cytosol, microsomes, plasma membrane) using differential centrifugation, followed by protein extraction and immunoblotting with BI1-specific antibodies. Microsomal fractions containing ER membranes should show enrichment of BI1 protein.

Immunohistochemistry using specific antibodies against rice BI1 can provide tissue-level localization information. This technique is particularly valuable for examining native protein localization without the potential artifacts of overexpression systems. For high-resolution studies, immunogold labeling combined with electron microscopy can precisely determine the membrane systems where BI1 resides.

Additionally, bimolecular fluorescence complementation (BiFC) can simultaneously visualize protein-protein interactions and their subcellular localization, as demonstrated for wheat BI1 and aquaporin interactions .

How does rice BI1 interact with membrane systems in plant cells?

Rice BI1 primarily interacts with the endoplasmic reticulum (ER) membrane system in plant cells, consistent with its function as an ER-resident cell death suppressor . The protein contains six to seven membrane-spanning segments that anchor it within the ER membrane , positioning it as an integral membrane protein rather than a peripheral membrane-associated factor. This transmembrane localization is critical for BI1 function in regulating ER stress responses and calcium homeostasis.

The interaction between BI1 and membrane systems likely involves several mechanisms:

  • Direct integration into the ER lipid bilayer through its multiple transmembrane domains, with specific lipid interactions potentially modulating its function

  • Formation of protein complexes with other ER-resident proteins, including aquaporins like TaPIP1 , which may influence membrane properties

  • Potential regulation of calcium flux across the ER membrane, affecting calcium-dependent signaling pathways

  • Possible influence on ER-plasma membrane contact sites, which are important for lipid transfer and signaling

The wheat BI1 homolog (TaBI-1.1) has been shown to co-localize with the aquaporin TaPIP1 on the ER membrane , suggesting that rice BI1 similarly participates in protein complexes at the ER. These interactions may be dynamic and regulated by stress conditions or developmental signals. The association of BI1 with membrane systems provides a physical platform for its function in stress sensing and cell death regulation, potentially by altering membrane properties, facilitating protein-protein interactions, or modulating the activity of other membrane-resident proteins involved in stress responses.

What expression systems provide optimal yields of functional recombinant rice BI1?

For optimal yields of functional recombinant rice BI1, researchers should carefully select expression systems suited to membrane proteins. The ideal expression system depends on the specific experimental goals, but several options have proven effective for similar proteins:

Eukaryotic systems:

  • Yeast systems (Saccharomyces cerevisiae or Pichia pastoris) represent excellent choices for rice BI1 expression, as demonstrated by successful expression of other plant BI1 proteins in yeast . Pichia pastoris offers advantages for membrane proteins due to its ability to grow to high densities and perform complex eukaryotic protein folding.

  • Insect cell/baculovirus systems provide superior eukaryotic protein processing capabilities. The Sf9 or High Five cell lines combined with the Bac-to-Bac or flashBAC systems typically yield well-folded membrane proteins.

  • Plant-based expression systems, particularly transient expression in Nicotiana benthamiana using Agrobacterium infiltration, offer the most native environment for plant proteins. For rice BI1, this system would provide proper folding and post-translational modifications.

The following table summarizes key parameters for rice BI1 expression systems:

Expression SystemYield PotentialFolding QualityPost-translational ModificationsScale-up PotentialRelative Cost
E. coliModerateLimitedMinimalExcellentLow
Yeast (Pichia)GoodGoodModerateGoodMedium
Insect cellsGoodVery goodGoodMediumHigh
Plant (transient)ModerateExcellentExcellentLimitedMedium

What purification strategies are most effective for rice BI1 protein?

Purification of rice BI1 protein requires specialized strategies optimized for integral membrane proteins. The following comprehensive approach can yield high-purity, functional protein:

Initial solubilization step:
Successful solubilization of BI1 from membranes requires careful detergent selection. Mild non-ionic detergents like DDM (n-dodecyl-β-D-maltoside) at 1-2% or CHAPS at 0.5-1% are recommended starting points. The solubilization should be performed at 4°C for 1-2 hours with gentle rotation. A detergent screen is advisable to determine optimal conditions, testing DDM, CHAPS, digitonin, and LMNG at various concentrations.

Affinity chromatography:
For tagged constructs (His6 or FLAG tags are recommended for BI1), metal affinity chromatography provides an effective first purification step. IMAC columns pre-equilibrated with running buffer containing 0.05-0.1% detergent (below CMC) should be used. Washing with 20-40 mM imidazole removes non-specific binders, followed by elution with 250-300 mM imidazole.

Size exclusion chromatography (SEC):
SEC represents a critical second purification step for achieving high purity and assessing protein quality. A Superdex 200 or similar column equilibrated with buffer containing detergent at 0.5× CMC effectively separates monomeric protein from aggregates and other contaminants. The elution profile provides valuable information about the oligomeric state of BI1.

Ion exchange chromatography:
As a potential third step, ion exchange chromatography can further polish the preparation. Based on the theoretical pI of rice BI1 (approximately 6-7), cation exchange at pH 5.5 or anion exchange at pH 8.0 can be effective.

Quality control:
Purified BI1 should be assessed by:

  • SDS-PAGE and western blotting to confirm identity and purity

  • Circular dichroism to verify secondary structure content (BI1 should show high α-helical content)

  • Thermal stability assays to ensure proper folding

  • Functional assays, such as liposome reconstitution or in vitro interaction studies with known partners

Throughout all purification steps, maintaining a stable detergent concentration above the critical micelle concentration (CMC) is essential to prevent protein aggregation.

What analytical techniques best characterize the structural properties of rice BI1?

Circular Dichroism (CD) Spectroscopy:
CD provides essential information about secondary structure composition. Rice BI1, with its predicted six to seven transmembrane helices , should exhibit strong negative peaks at 208 and 222 nm, characteristic of α-helical structures. Thermal melting CD experiments can assess protein stability and folding integrity. For optimal results, BI1 should be in a buffer with low chloride content (using fluoride salts if needed) and detergent concentrations kept at minimum working levels.

Nuclear Magnetic Resonance (NMR):
For detailed structural analysis, solution NMR can be employed, particularly for specific domains or peptide fragments of BI1. 15N-labeled protein preparations enable HSQC experiments to assess proper folding and potentially map interaction sites with binding partners. For full-length BI1, solid-state NMR may be more appropriate given its membrane-integrated nature.

Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):
HDX-MS provides valuable information about protein dynamics and solvent accessibility. This technique can identify regions of BI1 that undergo conformational changes upon interaction with binding partners or under different environmental conditions, providing functional insights without requiring complete structural determination.

Molecular Dynamics Simulations:
Complementing experimental approaches, MD simulations can model BI1 within a lipid bilayer, providing insights into dynamic behavior, lipid interactions, and conformational changes. Homology modeling based on known structures of related proteins can provide starting models for these simulations.

Through integration of these complementary approaches, researchers can build a comprehensive understanding of rice BI1 structure despite the challenges inherent in membrane protein structural biology.

How can rice BI1 be targeted for crop improvement strategies?

Rice BI1 presents several promising avenues for crop improvement strategies, particularly for enhancing stress tolerance. Based on the current understanding of BI1 function, several approaches can be considered:

Overexpression strategies:
Constitutive or stress-inducible overexpression of rice BI1 may enhance tolerance to various stresses by delaying inappropriate cell death responses. This approach may be particularly effective for improving heat and salinity tolerance, as BI1 homologs have been implicated in these stress responses . Targeted overexpression using tissue-specific or stress-inducible promoters would allow fine-tuned expression patterns that minimize potential developmental trade-offs.

CRISPR/Cas9-mediated modification:
Precise genome editing of specific BI1 domains may enhance its function without causing constitutive activation that could interfere with normal development. For example, modifying regulatory domains while preserving the core cell death suppression function could create rice varieties with improved stress tolerance. This approach has been successfully demonstrated for other rice genes involved in stress responses .

Interactome engineering:
Modifying BI1 interactions with partner proteins, such as aquaporins , represents another promising approach. By strengthening or modifying these interactions, researchers could enhance water transport under stress conditions or alter calcium signaling dynamics to improve stress responses.

Promoter mining and selection:
Identifying natural variants of BI1 promoters with enhanced responsiveness to stress signals could enable marker-assisted selection of rice varieties with optimized BI1 expression patterns. This non-transgenic approach may face fewer regulatory hurdles compared to transgenic strategies.

The potential benefits of these strategies include:

  • Enhanced tolerance to multiple stresses, including heat, drought, and salinity

  • Improved disease resistance through modulation of cell death responses

  • Potential yield stability under fluctuating environmental conditions

What are the key unresolved questions about rice BI1 function?

Despite significant advances in understanding rice BI1, several critical questions remain unresolved that present important opportunities for future research:

Regulatory mechanisms: The precise mechanisms regulating rice BI1 activity at the post-translational level remain poorly understood. While transcript regulation by hormones like salicylic acid and abscisic acid has been documented in wheat BI1 , how these signals are integrated at the protein level requires further investigation. Key questions include: What post-translational modifications regulate BI1 activity? How do membrane lipid compositions affect BI1 function during stress responses?

Signaling cascades: The downstream signaling events triggered by BI1 activation/inhibition remain largely uncharacterized. What are the immediate molecular consequences of BI1 activation during stress responses? How does BI1 communicate with the cellular machinery to prevent inappropriate cell death? The specific calcium signaling mechanisms potentially regulated by BI1 also require clarification.

Evolutionary adaptations: Rice varieties adapted to different environmental conditions may show variations in BI1 sequence or regulation. Do these variations contribute to differential stress tolerance across rice ecotypes? Comparative genomics approaches could reveal how BI1 has evolved across rice varieties adapted to diverse environments.

Interactome complexity: While interaction with aquaporins has been established for wheat BI1 , the complete interactome of rice BI1 remains undefined. Does BI1 form different protein complexes under various stress conditions? How dynamic are these interactions? Comprehensive protein interaction studies using techniques like proximity labeling (BioID) could address these questions.

Functional redundancy: The degree of functional redundancy between BI1 and other cell death regulators in rice remains unclear. What compensatory mechanisms exist when BI1 function is compromised? Are there tissue-specific differences in this functional redundancy? Understanding these relationships would inform more effective genetic intervention strategies.

Subcellular dynamics: While BI1 is primarily localized to the ER , its potential redistribution under stress conditions and the functional significance of such movements require investigation. Does BI1 relocalize to specific ER subdomains during stress responses? How does this affect its function?

Addressing these questions will require integrative approaches combining molecular, cellular, and systems biology techniques to build a comprehensive understanding of this important cell death regulator.

How does rice BI1 compare functionally to its homologs in other species?

Rice BI1 shares significant functional conservation with homologs across diverse species, yet exhibits species-specific adaptations that reflect evolutionary divergence. Comparative analysis reveals both common mechanisms and unique features across BI1 proteins:

Conservation across kingdoms:
The fundamental cell death suppression function of BI1 is remarkably conserved from yeast to plants to mammals. Rice OsBI-1 can functionally complement mammalian Bax-induced cell death in yeast , demonstrating the ancient evolutionary origin of this cellular mechanism. This functional complementation suggests a core mechanism of action that has been preserved for hundreds of millions of years of separate evolution. The amino acid sequence similarity of approximately 45% between plant and animal BI1 proteins further supports this conservation .

Plant-specific adaptations:
Despite this conservation, plant BI1 proteins, including rice BI1, have evolved specific adaptations to plant cellular contexts. Plant BI1 shows distinctive responses to plant hormones, with the wheat homolog TaBI-1.1 being upregulated by salicylic acid but downregulated by abscisic acid - a regulation pattern that would be unique to plants. Additionally, plant BI1 proteins interact with plant-specific partners like aquaporins (PIPs) , suggesting unique functional integration into plant cellular networks.

Species-specific differences:
Interesting functional differences exist even between plant BI1 homologs. While the deletion of the single Arabidopsis AtCPR5 gene causes severely dwarfed plants, mutations in rice homologs show less dramatic growth defects , suggesting different degrees of functional redundancy or divergence in developmental roles. Similarly, the specific role of BI1 in pathogen responses may vary between species, with wheat TaBI-1.1 showing clear involvement in bacterial resistance .

The following table summarizes key functional comparisons between rice BI1 and homologs in other organisms:

SpeciesCell Death SuppressionER Stress ResponsePathogen ResponseAbiotic Stress ToleranceDevelopmental Role
Rice (O. sativa)ConservedPrimaryLikely importantHeat, salinityMinimal phenotype when mutated
Wheat (T. aestivum)ConservedPrimaryEnhanced bacterial resistanceMultiple stressesModerate
ArabidopsisConservedPrimaryDocumentedDocumentedSevere when mutated
MammalsConservedPrimaryN/AN/AEssential in some tissues
Fungi (M. robertsii)PartialPrimaryImpaired virulenceHeatImpaired development

This comparative analysis highlights both the fundamental conservation of BI1 function in cell death regulation and the species-specific adaptations that likely reflect different environmental pressures and cellular contexts across diverse organisms.

What are the emerging technologies that could advance rice BI1 research?

Emerging technologies offer exciting opportunities to deepen our understanding of rice BI1 function and application. CRISPR/Cas genome editing technologies represent one of the most powerful approaches for BI1 research, enabling precise modification of specific domains to investigate structure-function relationships . Base editing and prime editing refinements allow single nucleotide modifications without double-strand breaks, permitting subtle alterations to regulatory regions or specific amino acids in BI1. Additionally, CRISPR activation/interference (CRISPRa/CRISPRi) systems enable targeted modulation of BI1 expression without permanent genetic changes.

Advanced imaging technologies are revolutionizing protein localization studies. Super-resolution microscopy techniques such as STORM and PALM can visualize BI1 distribution in membranes with nanometer precision, potentially revealing functional microdomains. Live-cell imaging with optogenetic tools could allow real-time visualization and manipulation of BI1 activity during stress responses.

Multi-omics integration approaches combine transcriptomics, proteomics, metabolomics, and phenomics data to build comprehensive models of BI1 function within cellular networks. These approaches are particularly valuable for understanding how BI1 influences global cellular responses to stress. Single-cell technologies extend these approaches to examine cell-type specific functions of BI1, which may be especially important for understanding its role in specific tissues or developmental contexts.

Structural biology techniques continue to advance, with cryo-electron microscopy now capable of resolving membrane protein structures at near-atomic resolution. This technology, combined with computational approaches like AlphaFold2, could finally reveal the detailed structure of rice BI1, illuminating its mechanism of action at the molecular level.

Field-based phenotyping using drones, sensors, and IoT devices enables assessment of BI1-modified plants under realistic growing conditions, bridging the gap between laboratory findings and agricultural applications. These technologies collectively promise to accelerate both fundamental understanding and practical applications of rice BI1 research.

How might understanding rice BI1 contribute to broader plant biology concepts?

Understanding rice BI1 has significant implications for broader plant biology concepts, particularly in elucidating fundamental mechanisms of programmed cell death regulation across eukaryotes. As an evolutionary ancient regulator conserved from fungi to plants and animals, BI1 serves as a model for studying deep homology in cellular survival mechanisms . The functional conservation observed when rice BI1 is expressed in heterologous systems highlights universal aspects of cell death regulation that transcend kingdom boundaries, providing insights into the evolution of these essential cellular processes.

Rice BI1 research also contributes to our understanding of plant stress signaling networks and their integration. The dual responsiveness of BI1 homologs to both biotic and abiotic stresses, as seen with wheat BI1's differential regulation by salicylic acid and abscisic acid , illuminates how plants coordinate potentially conflicting stress response pathways. This coordination is critical for plant survival in complex natural environments where multiple stresses often occur simultaneously.

The interaction between BI1 and aquaporins reveals unexpected connections between cell death regulation and water homeostasis, suggesting novel regulatory mechanisms that may be broadly relevant across plant species. These findings contribute to emerging concepts about the interconnectedness of seemingly disparate physiological processes in plants.

From an evolutionary perspective, comparing rice BI1 with homologs in other species provides insights into how conserved proteins acquire specialized functions while maintaining core activities. This evolutionary plasticity may represent a general principle in how plants adapt ancient cellular machinery to meet species-specific challenges.

Finally, rice BI1 research demonstrates the complex relationship between stress responses and development, highlighting how plants balance immediate survival needs with long-term growth requirements. This balancing act represents a fundamental concept in plant biology with implications for understanding trade-offs between stress resistance and productivity in crop species.

What are the most promising translational applications of rice BI1 research?

Rice BI1 research offers several promising translational applications that could significantly impact agriculture and food security. Climate resilience engineering represents perhaps the most immediate application, as modulating BI1 expression or activity could enhance rice tolerance to multiple abiotic stresses. Since BI1 functions in heat stress tolerance pathways and likely influences responses to salinity stress , optimized variants could contribute to developing rice cultivars that maintain productivity under increasingly variable climate conditions. This application is particularly timely given global climate change projections.

Disease resistance improvement offers another valuable application. The wheat BI1 homolog has demonstrated roles in enhancing resistance to bacterial pathogens through salicylic acid signaling pathways . Similar mechanisms in rice could be exploited to develop varieties with broad-spectrum disease resistance, potentially reducing reliance on chemical pesticides. This approach could be especially valuable for sustainable rice production systems.

Yield stability enhancement under stress conditions represents a critical translational goal. By preventing inappropriate cell death during moderate stress episodes, optimized BI1 variants could help maintain photosynthetic capacity and reproductive development even under suboptimal conditions. This application addresses the fundamental challenge of closing the gap between potential and actual yields in many rice-growing regions.

The following table summarizes potential translational applications of rice BI1 research and their implementation strategies:

ApplicationImplementation StrategyExpected BenefitDevelopment TimelinePotential Challenges
Climate resilienceCRISPR/Cas9 editing or optimized overexpressionEnhanced tolerance to heat, drought, salinityMedium-term (3-5 years)Potential trade-offs with yield potential
Disease resistanceModulation of BI1-mediated defense pathwaysReduced pathogen susceptibilityMedium-term (3-5 years)Pathogen adaptation, resistance durability
Yield stabilityTissue-specific or stress-inducible expressionMaintained productivity under stressLong-term (5-7 years)Regulatory approval, public acceptance
Nutritional qualityReduced post-harvest losses through delayed senescenceExtended shelf life, reduced wasteLong-term (5-7 years)Complex regulation of post-harvest physiology

These translational applications highlight the potential of fundamental research on rice BI1 to address practical challenges in agriculture, demonstrating the valuable interplay between basic molecular studies and applied crop improvement efforts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.