Recombinant Oryza sativa subsp. japonica Bidirectional sugar transporter SWEET15 (SWEET15)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Oryza sativa subsp. japonica Bidirectional Sugar Transporter SWEET15 (SWEET15)

Recombinant Oryza sativa subsp. japonica SWEET15 is a purified, recombinant protein derived from the japonica rice subspecies, engineered for research applications. It belongs to the SWEET (Sugars Will Eventually be Exported Transporter) family, a class of bidirectional sugar transporters unique to plants. SWEET15 mediates the proton-independent transport of sucrose across cell membranes, playing critical roles in sugar allocation during plant growth, particularly in seed development and stress responses .

Gene and Protein Characteristics

PropertyDetails
Gene NameSWEET15, OsSWEET15
Locus NamesOs02g0513100, LOC_Os02g30910
Protein Length319 amino acids (full-length)
AA SequenceMAFMSMERSTWAFTFGILGNLISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCML... (Partial)
Subcellular LocalizationPlasma membrane (primary), vacuolar membrane (secondary)
FunctionBidirectional sucrose transport (efflux and influx)

The recombinant protein is produced in a Tris-based buffer with 50% glycerol and stored at -20°C .

Sucrose Transport and Seed Development

SWEET15 homologs in other crops (e.g., tomato SlSWEET15, soybean GmSWEET15) highlight conserved roles in sucrose unloading during seed maturation:

  • Seed Coat to Embryo Transport: Facilitates sucrose efflux from seed coat cells into the apoplasm, enabling uptake by developing embryos .

  • Phloem Unloading: Mediates sucrose release from phloem cells into sink tissues (e.g., grains) during long-distance transport .

In rice, OsSWEET15 may contribute to grain filling by regulating sucrose distribution between maternal (seed coat) and filial (endosperm/embryo) tissues, though direct evidence remains limited .

Stress Adaptation

While not directly studied in japonica rice, SWEET family members in other species are implicated in abiotic stress responses. For example:

  • Drought/Salinity Tolerance: SWEET-mediated sucrose reallocation may stabilize cellular osmotic balance .

  • Cold Stress: Potential overlap with japonica-specific cold-responsive pathways .

Recombinant Protein Utility

The recombinant SWEET15 protein is used in:

  • Functional Assays: Yeast complementation or Xenopus oocyte transport studies to validate sucrose transport activity .

  • Localization Studies: Fluorescence tagging (e.g., GFP) to map subcellular distribution in plant cells .

Comparative Analysis with Other SWEET Transporters

TransporterSpeciesPrimary FunctionKey Differences
OsSWEET15O. sativa japonicaSucrose efflux/influx (putative)Bidirectional activity, plasma/vacuolar localization
SlSWEET15TomatoPhloem unloading, seed coat effluxPlasma membrane-specific, critical for fruit development
GmSWEET15SoybeanEndosperm-to-embryo sucrose transportPlasma membrane localization, embryo essential
OsSUT1O. sativaSucrose import into phloem (SE-CC)Proton-coupled symporter, phloem loading

Research Gaps and Future Directions

  • Direct Functional Validation: No published studies on OsSWEET15 knockout mutants in rice.

  • Subcellular Dynamics: Dual localization (plasma/vacuolar membranes) warrants further investigation.

  • Stress-Responsive Networks: Potential links to japonica-specific stress adaptation pathways remain unexplored .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SWEET15; Os02g0513100; LOC_Os02g30910; OJ1789_D08.23; OsJ_06889; Bidirectional sugar transporter SWEET15; OsSWEET15
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
SWEET15
Target Protein Sequence
MAFMSMERSTWAFTFGILGNLISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCML WMYYAFVKSGAELLVTINGVGCVIETVYLAMYLAYAPKSARMLTAKMLLGLNIGLFGVIA LVTLLLSRGELRVHVLGWICVAVSLSVFAAPLSIIRLVIRTKSVEFMPFSLSFFLVLSAV IWFLYGLLKKDVFVALPNVLGFVFGVAQMALYMAYRSKKPLVASSSSAVVAAGLEIKLPE HVKEVQAVAKGAVAAAPEGRISCGAEVHPIDDVMPSEVVEVKVDDEETNRTDEMAGDGDH AMVRTEQIIKPDMAIVVEV
Uniprot No.

Target Background

Function
This protein mediates both low-affinity uptake and efflux of sugar across the plasma membrane. It contributes to blight susceptibility and confers TAL effector-mediated susceptibility to Xanthomonas oryzae pv. oryzae.
Database Links

KEGG: osa:4329464

UniGene: Os.16044

Protein Families
SWEET sugar transporter family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is SWEET15 and what is its fundamental role in rice biology?

SWEET15 is a member of the SWEET (Sugars Will Eventually be Exported Transporter) family in rice (Oryza sativa subsp. japonica). It functions as a bidirectional uniporter that facilitates the diffusion of sugars, primarily sucrose, across cell membranes along concentration gradients. Unlike other sugar transporters such as MSTs and SUTs that require proton coupling, SWEET15 does not depend on pH gradients for transport activity .

SWEET15 plays a critical role in seed filling processes, particularly in the transfer of sucrose from maternal tissues to developing endosperm. Based on expression patterns and knockout studies, SWEET15 shows all the hallmarks of being necessary for seed filling with sucrose efflux functions at specific tissue interfaces, including the nucellar projection and the nucellar epidermis/aleurone interface .

How does SWEET15 expression vary throughout rice plant development?

SWEET15 shows tissue-specific and developmentally regulated expression patterns. In rice caryopses (developing grains), SWEET15 exhibits high mRNA levels during seed development. Protein localization studies have identified four key expression sites:

  • All regions of the nucellus at early developmental stages

  • The nucellar projection close to the dorsal vein

  • The nucellar epidermis surrounding the endosperm

  • The aleurone layer

This expression pattern indicates SWEET15's specialized role in facilitating sugar movement during critical stages of grain filling. The temporal and spatial regulation suggests coordinated activity with other transporters in establishing sugar gradients necessary for proper endosperm development.

What structural features enable SWEET15's bidirectional transport capacity?

While the exact structure of SWEET15 hasn't been fully resolved, insights from related SWEET proteins reveal key structural elements. SWEET transporters function through a "rocking-type motion" mechanism with three distinct conformational states: outward open, inward open, and occluded conformations .

The protein contains seven transmembrane domains (TM1-7) with specific amino acid residues that are critical for substrate recognition and binding. By homology with other SWEET proteins, particularly AtSWEET13 which has been crystallized at 2.8-Å resolution, SWEET15 likely contains conserved amino acid residues equivalent to the ten key residues identified in AtSWEET13, including:

  • Serine and Leucine from TM1

  • Asparagine and Tryptophan from TM2

  • Asparagine from TM3

  • Serine and Methionine from TM5

  • Asparagine and Tryptophan from TM6

  • Asparagine from TM7

These residues are predicted to form a substrate-binding pocket that accommodates sucrose molecules during transport.

How should researchers approach expression and purification of recombinant SWEET15 for structural studies?

Recombinant SWEET15 protein can be expressed and purified using the following methodology:

  • Construct design: The full-length coding sequence of SWEET15 (319 amino acids) should be cloned into an appropriate expression vector with an affinity tag (His-tag is commonly used) for purification purposes .

  • Expression system: While bacterial expression systems can be used, membrane proteins often require eukaryotic systems such as yeast (Pichia pastoris) or insect cells for proper folding and function.

  • Purification protocol:

    • Membrane fraction isolation through ultracentrifugation

    • Solubilization using mild detergents like n-dodecyl-β-D-maltoside (DDM)

    • Affinity chromatography using the engineered tag

    • Size exclusion chromatography for further purification

  • Storage considerations: The purified protein should be stored in Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage. Repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week .

How does SWEET15 cooperate with SWEET11 in rice seed filling?

SWEET15 and SWEET11 work collaboratively in the rice seed filling process, demonstrating functional redundancy and complementarity. Their coordinated roles have been established through several experimental approaches:

  • Expression pattern overlap: Both transporters show high mRNA levels in developing caryopses with partially overlapping but distinct expression domains .

  • Functional complementarity: Single knockout mutants of either SWEET11 or SWEET15 show mild phenotypes, but double knockout mutants (ossweet11;15) display severe defects in seed development - they accumulate starch in the pericarp while failing to develop functional endosperm .

  • Tissue-specific functions:

    • Both transporters function at the nucellar projection near the dorsal vein

    • They facilitate sugar movement across the nucellar epidermis/aleurone interface

    • Together they establish the concentration gradients necessary for proper endosperm filling

This cooperative relationship delineates two major steps for apoplasmic seed filling in rice: first, sucrose efflux from maternal tissues into the apoplastic space, and second, uptake into the developing endosperm .

What phenotypic effects are observed in SWEET15 knockout or overexpression lines?

Knockout Effects:
The most striking phenotypes are observed in double knockout lines (ossweet11;15), which exhibit:

  • Abnormal starch accumulation in the pericarp

  • Lack of functional endosperm development

  • Severely compromised seed filling

  • Reduced grain yield and quality

Single SWEET15 knockout mutants exhibit more subtle phenotypes due to partial functional redundancy with SWEET11, but may show:

Overexpression Effects:
While specific data on SWEET15 overexpression wasn't provided in the search results, based on SWEET transporter function, potential effects might include:

  • Altered source-sink relationships in the plant

  • Modified carbohydrate partitioning

  • Potentially enhanced seed filling if other components of the transport pathway aren't limiting

  • Possible impacts on stress responses or pathogen susceptibility

What genomic editing approaches are most effective for generating SWEET15 mutants?

Based on successful studies with SWEET15, the following genomic editing approaches have proven effective:

  • CRISPR/Cas9 system:

    • Design guide RNAs targeting conserved regions of the SWEET15 coding sequence

    • Preferably target early exons to ensure complete loss of function

    • Screen for frameshift mutations that result in premature stop codons

    • Verify mutations through sequencing and assess protein loss through Western blotting

  • Target selection considerations:

    • Avoid regions with sequence similarity to other SWEET family members to prevent off-target effects

    • For studying specific transport mechanisms, target conserved residues in the substrate-binding pocket

    • For studying tissue-specific functions, consider using tissue-specific promoters to drive Cas9 expression

  • Validation approaches:

    • Complementation studies with wild-type SWEET15 to confirm phenotype causality

    • Creation of double mutants (e.g., ossweet11;15) to assess functional redundancy

    • Use of translational reporter fusions to confirm loss of protein expression

What methods are recommended for analyzing SWEET15 expression and localization in planta?

Several complementary approaches can be employed to comprehensively analyze SWEET15 expression and localization:

  • mRNA quantification:

    • Quantitative RT-PCR for tissue-specific and developmental expression profiling

    • RNA-seq for global transcriptome analysis and co-expression studies

    • In situ hybridization for high-resolution spatial expression analysis in developing tissues

  • Protein localization:

    • Translational promoter-reporter fusions (SWEET15 promoter driving GFP or other fluorescent proteins)

    • Immunohistochemistry using specific antibodies against SWEET15

    • Subcellular fractionation combined with Western blotting

  • Histochemical analyses:

    • Starch staining with iodine to visualize effects on carbohydrate accumulation

    • In situ enzyme activity assays to assess physiological consequences of SWEET15 absence/presence

    • Immunogold labeling combined with electron microscopy for precise subcellular localization

  • Transport activity:

    • Electrophysiological measurements in heterologous expression systems

    • Radiotracer studies to track sugar movement in planta

    • FRET-based sensors to monitor sugar dynamics in living tissues

How does SWEET15 contribute to plant-pathogen interactions in rice?

While the search results don't specifically detail SWEET15's role in plant-pathogen interactions, SWEET family transporters are known to be important in this context:

  • Pathogen hijacking mechanism: Several pathogens target SWEET transporters to induce their expression, promoting sugar efflux from host cells into the apoplast where pathogens can access these nutrients .

  • Research approach for SWEET15-pathogen studies:

    • Monitor SWEET15 expression changes during pathogen infection

    • Assess whether SWEET15 knockout mutants show altered susceptibility to pathogens

    • Identify potential pathogen effectors that might target SWEET15 promoter regions

    • Investigate if natural SWEET15 allelic variation correlates with disease resistance

  • Methodological considerations:

    • Use of reporter constructs to monitor SWEET15 promoter activity during infection

    • Promoter analysis to identify potential pathogen-responsive elements

    • Yeast one-hybrid assays to identify transcription factors that regulate SWEET15 during pathogen attack

What biotechnological approaches can utilize SWEET15 for improving crop yield or quality?

Based on SWEET15's critical role in seed filling, several biotechnological approaches could be developed:

  • Targeted expression modification:

    • Fine-tuning SWEET15 expression levels in specific tissues to enhance sugar transport to developing seeds

    • Engineering promoter elements to optimize expression timing during grain filling

    • Using tissue-specific promoters to enhance SWEET15 expression specifically at key interfaces for seed filling

  • Protein engineering:

    • Modification of key amino acid residues to potentially enhance transport efficiency

    • Engineering SWEET15 for altered substrate specificity or transport kinetics

    • Creation of chimeric transporters with desirable characteristics from different SWEET family members

  • Pathway optimization:

    • Coordinated engineering of SWEET15 along with other transporters in the seed-filling pathway

    • Balancing source-sink relationships by modifying both sugar production and transport systems

    • Stress-responsive expression systems to maintain seed filling under adverse conditions

ApproachPotential BenefitsTechnical ChallengesResearch Prerequisites
SWEET15 overexpressionEnhanced seed filling capacityMay disrupt source-sink balanceTissue-specific promoter identification
Modifying transport kineticsImproved sugar transport efficiencyRequires detailed protein structure knowledgeCrystal structure determination
Stress-inducible expressionMaintained yield under stressComplex regulatory networksIdentification of suitable stress-responsive elements
Engineering substrate specificityModified sugar composition in seedsMay affect other metabolic pathwaysDetailed transport mechanism understanding

How does SWEET15 activity integrate with broader carbohydrate metabolism in developing rice grains?

SWEET15 functions within a complex network of carbohydrate metabolism and transport processes:

  • Source-sink integration:

    • SWEET15 facilitates the critical transfer of sucrose from maternal tissues to filial tissues

    • This transport is coordinated with photosynthetic activity in source tissues (leaves)

    • The process establishes the major apoplasmic pathway for seed filling in rice

  • Metabolic coordination:

    • After SWEET15-mediated transport, sucrose must be metabolized within the endosperm

    • This requires coordination with sucrose-metabolizing enzymes (invertases, sucrose synthases)

    • Starch biosynthetic enzymes then convert the imported sugars to storage starch

  • Regulatory network:

    • SWEET15 activity is likely regulated in response to sugar levels, developmental cues, and environmental signals

    • This coordination ensures appropriate sugar partitioning throughout plant development

    • The transporter may interact with signaling pathways responsive to plant energy status

What methodological approaches can resolve contradictory findings about SWEET15 function?

Researchers encountering contradictory findings regarding SWEET15 function should consider these methodological approaches:

  • Genetic background consideration:

    • Use multiple genetic backgrounds to determine if effects are genotype-specific

    • Complement mutations with the wild-type gene to confirm phenotype causality

    • Consider the potential effects of natural variation in SWEET15 sequences

  • Environmental factor control:

    • Carefully control and document growth conditions, as sugar transport can be highly responsive to environmental cues

    • Test phenotypes under multiple environmental conditions to identify context-dependent effects

    • Monitor diurnal patterns, as sugar transport often shows strong circadian regulation

  • Multi-level analysis:

    • Combine transcriptomic, proteomic, and metabolomic approaches for comprehensive understanding

    • Use both in vitro transport assays and in planta studies to validate findings

    • Apply mathematical modeling to integrate data and resolve apparent contradictions

  • Tissue-specific and temporal resolution:

    • Improve spatial and temporal resolution of analyses to distinguish localized effects

    • Use cell-type specific approaches rather than whole-tissue analyses

    • Employ time-course studies to capture dynamic aspects of SWEET15 function

What are the key unanswered questions about SWEET15 that warrant further investigation?

Several important questions remain unanswered regarding SWEET15 function and regulation:

  • Structural dynamics:

    • How does the three-dimensional structure of SWEET15 change during the transport cycle?

    • What are the specific residues responsible for substrate specificity?

    • Can the transport efficiency be enhanced through targeted mutations?

  • Regulatory mechanisms:

    • What transcription factors directly regulate SWEET15 expression?

    • How is SWEET15 activity post-translationally regulated?

    • Are there protein-protein interactions that modulate SWEET15 function?

  • Evolutionary considerations:

    • How has SWEET15 function diversified across different grass species?

    • What selective pressures have shaped SWEET15 evolution in cultivated rice?

    • Are there naturally occurring SWEET15 variants with enhanced transport properties?

  • Broader physiological roles:

    • Does SWEET15 play roles beyond seed filling in rice development?

    • How does SWEET15 function under different abiotic stress conditions?

    • Is SWEET15 involved in symbiotic relationships with beneficial microorganisms?

What emerging technologies could advance our understanding of SWEET15 function?

Cutting-edge methodologies that could significantly enhance SWEET15 research include:

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize SWEET15 distribution and dynamics at the nanoscale

    • Label-free imaging approaches to monitor sugar transport in living tissues

    • Correlative light and electron microscopy to connect function with ultrastructure

  • Single-cell approaches:

    • Single-cell transcriptomics to resolve cell-specific expression patterns

    • Cell-specific proteomics to identify SWEET15 interacting partners

    • CRISPR-based cell-type specific mutagenesis

  • Structural biology advances:

    • Cryo-electron microscopy to resolve SWEET15 structure in different conformational states

    • Molecular dynamics simulations to model transport mechanisms

    • Hydrogen-deuterium exchange mass spectrometry to map conformational changes

  • Systems biology integration:

    • Multi-omics data integration to position SWEET15 in broader metabolic networks

    • Genome-scale metabolic modeling to predict effects of SWEET15 modification

    • Network analysis to identify regulatory hubs controlling SWEET15 expression

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.