Recombinant Oryza sativa subsp. japonica Bidirectional sugar transporter SWEET2b (SWEET2B)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SWEET2B; Os01g0700100; LOC_Os01g50460; OsJ_03146; P0047E11.3; P0454A11.22; Bidirectional sugar transporter SWEET2b; OsSWEET2b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
SWEET2B
Target Protein Sequence
MDSLYDISCFAAGLAGNIFALALFLSPVTTFKRILKAKSTERFDGLPYLFSLLNCLICLW YGLPWVADGRLLVATVNGIGAVFQLAYICLFIFYADSRKTRMKIIGLLVLVVCGFALVSH ASVFFFDQPLRQQFVGAVSMASLISMFASPLAVMGVVIRSESVEFMPFYLSLSTFLMSAS FALYGLLLRDFFIYFPNGLGLILGAMQLALYAYYSRKWRGQDSSAPLLLA
Uniprot No.

Target Background

Function
This protein mediates both low-affinity uptake and efflux of sugars across the plasma membrane.
Database Links

KEGG: osa:4326923

STRING: 39947.LOC_Os01g50460.1

UniGene: Os.2019

Protein Families
SWEET sugar transporter family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is SWEET2b and what is its functional significance in rice?

SWEET2b (OsSWEET2b) is a bidirectional sugar transporter belonging to the SWEET family in Oryza sativa subsp. japonica (rice). The protein is encoded by the SWEET2B gene (Ordered Locus Names: Os01g0700100, LOC_Os01g50460) . SWEET transporters play crucial roles in sugar translocation between adjacent cells in plants, facilitating the movement of carbohydrates from source to sink tissues .

The SWEET family in rice comprises 21 members that, together with the sucrose-proton symporter (SUT) family, constitute the primary sugar transport system in the plant . While some SWEET transporters have been shown to be indispensable for normal plant function, gene knockout studies suggest that many SWEET members, potentially including SWEET2b, may not be as critical for plant growth and development based on mutant phenotype analysis .

What are the optimal conditions for storing and handling recombinant SWEET2b protein?

For optimal stability and activity of recombinant SWEET2b protein, researchers should adhere to the following storage and handling recommendations:

  • Store the protein at -20°C for regular storage

  • For extended storage, conserve at -20°C or -80°C

  • Working aliquots may be stored at 4°C for up to one week

  • Avoid repeated freezing and thawing cycles as this can compromise protein integrity

  • The protein is typically supplied in a Tris-based buffer with 50% glycerol, optimized for stability

These conditions help maintain the structural integrity and functional activity of the recombinant protein for experimental applications.

How does SWEET2b expression vary across different tissues and developmental stages?

SWEET family gene expression in rice generally focuses on source, transport, and sink organs—specifically the leaf, stem, and grain—where carbohydrate production, allocation, and storage occur . While specific data for SWEET2b is limited in the provided materials, research on SWEET transporters in rice suggests tissue-specific and developmental regulation.

For experimental determination of SWEET2b expression patterns, researchers should consider:

  • Quantitative RT-PCR analysis of tissue samples collected at different developmental stages

  • RNA-seq analysis to compare expression levels across tissues

  • Promoter-reporter fusion studies (e.g., using GUS or fluorescent proteins) to visualize expression in planta

  • Immunolocalization using SWEET2b-specific antibodies

Comparing expression patterns with other SWEET family members can provide insights into functional specialization within the family.

What role does SWEET2b play in stress responses and pathogen interactions?

SWEET transporters in rice have been implicated in both biotic and abiotic stress responses . While specific information about SWEET2b's role is not detailed in the provided materials, several methodological approaches can address this question:

  • Abiotic stress studies: Expose wild-type and SWEET2b knockout/overexpression lines to various stresses (drought, salinity, temperature extremes), then monitor physiological parameters and sugar distribution

  • Pathogen challenge experiments: Inoculate plants with rice pathogens and analyze:

    • Changes in SWEET2b expression during infection

    • Susceptibility differences between wild-type and SWEET2b-modified plants

    • Sugar efflux patterns in infected tissues

  • Hormonal response analysis: Determine if SWEET2b expression is regulated by stress hormones such as abscisic acid, jasmonic acid, or salicylic acid

This research is particularly relevant as some SWEET transporters are known to be hijacked by pathogens to acquire nutrients from host plants.

How can researchers effectively study SWEET2b transport kinetics?

Understanding the transport kinetics of SWEET2b requires specialized approaches:

  • Heterologous expression systems:

    • Xenopus oocytes for electrophysiological measurements

    • Yeast mutants deficient in sugar transport

    • Mammalian cell lines for fluorescence-based transport assays

  • Radiolabeled sugar transport assays:

    • Use 14C-labeled sugars to measure uptake/efflux rates

    • Determine Km and Vmax values for different substrates

    • Assess bidirectional transport capabilities

  • Fluorescent sugar analogs:

    • Employ fluorescent glucose analogs (e.g., 2-NBDG) to visualize transport

    • Perform real-time imaging of sugar movement in living cells

  • Liposome reconstitution:

    • Incorporate purified SWEET2b into liposomes

    • Measure sugar transport in a controlled membrane environment

These approaches can reveal the sugar specificity, transport rates, and regulatory mechanisms of SWEET2b.

What are effective strategies for generating and validating SWEET2b knockout or overexpression lines?

Creating genetically modified rice lines is essential for functional studies of SWEET2b:

  • CRISPR-Cas9 genome editing:

    • Design sgRNAs targeting conserved regions of SWEET2b

    • Screen for mutations using PCR and sequencing

    • Validate protein loss using Western blotting

  • RNAi-mediated knockdown:

    • Design constructs targeting unique regions of SWEET2b mRNA

    • Quantify knockdown efficiency using qRT-PCR

    • Assess protein reduction via immunoblotting

  • Overexpression approaches:

    • Use constitutive (e.g., CaMV 35S, ubiquitin) or tissue-specific promoters

    • Verify expression levels in transgenic lines

    • Include epitope tags for protein detection if antibodies are unavailable

  • Complementation studies:

    • Reintroduce wild-type or mutated versions into knockout backgrounds

    • Test for rescue of phenotypes to confirm specificity

Phenotypic analysis should include growth parameters, sugar content analysis, and stress response assays to comprehensively characterize the functional impact of SWEET2b modification.

How can researchers effectively purify active SWEET2b protein for biochemical studies?

Obtaining pure, active SWEET2b protein represents a significant challenge due to its membrane-embedded nature:

  • Expression system selection:

    • Prokaryotic systems (E. coli) with specialized strains for membrane proteins

    • Eukaryotic systems (yeast, insect cells) for proper folding and post-translational modifications

    • Cell-free systems for direct synthesis into detergent micelles or nanodiscs

  • Solubilization strategies:

    • Screen detergents (DDM, LMNG, digitonin) for optimal extraction

    • Consider styrene-maleic acid lipid particles (SMALPs) for native-like environment preservation

    • Test different buffer compositions for stability enhancement

  • Purification approaches:

    • Affinity chromatography using His-tag, FLAG-tag, or other epitope tags

    • Size exclusion chromatography for homogeneity assessment

    • Ion exchange chromatography for additional purity

  • Activity validation:

    • Reconstitute into proteoliposomes for functional assays

    • Assess protein folding using circular dichroism spectroscopy

    • Verify homogeneity using dynamic light scattering

The recombinant SWEET2b product described in the search results is supplied with a tag (though the specific tag type is determined during the production process), which can facilitate purification using affinity chromatography methods .

How do researchers resolve contradictory findings in SWEET transporter studies?

The field of sugar transporter research sometimes presents conflicting results, similar to the contradictory findings on rice consumption and diabetes risk observed across different populations . Researchers studying SWEET2b should:

  • Consider genetic background effects:

    • Different rice varieties may show variable SWEET2b functions

    • Genetic redundancy among SWEET family members may mask phenotypes

    • Background mutations in laboratory strains could influence results

  • Evaluate methodological differences:

    • Expression level variations in different systems

    • Assay sensitivity and specificity differences

    • Environmental conditions during experiments

  • Integrate multiple approaches:

    • Combine in vitro biochemical assays with in vivo functional studies

    • Use both gain-of-function and loss-of-function strategies

    • Apply complementary imaging and analytical techniques

  • Perform meta-analyses:

    • Systematically review published data on SWEET transporters

    • Account for regional and subspecies variations

    • Identify patterns across studies despite individual contradictions

This multi-faceted approach can help reconcile apparently contradictory findings, similar to how researchers have addressed contradictory results regarding rice consumption and diabetes across different populations .

What bioinformatic resources are most valuable for SWEET2b research?

Computational approaches provide valuable insights for SWEET2b research:

  • Sequence analysis tools:

    • UniProt (Q5N8J1) for sequence information and annotations

    • BLAST for identifying homologs in other species

    • Multiple sequence alignment tools for evolutionary analysis

  • Structural prediction resources:

    • AlphaFold/RoseTTAFold for 3D structure prediction

    • TMHMM/TOPCONS for transmembrane domain prediction

    • Molecular dynamics simulations for transport mechanism modeling

  • Expression databases:

    • Rice Expression Database for tissue-specific expression patterns

    • Stress response databases to identify conditions affecting SWEET2b regulation

    • Co-expression networks to identify functionally related genes

  • Genomic resources:

    • Rice genome browsers for identifying regulatory elements

    • Epigenomic databases for methylation and chromatin structure information

    • Comparative genomics tools for evolutionary insights

These computational resources complement experimental approaches and can guide hypothesis formation and experimental design.

What are emerging technologies that could advance SWEET2b research?

Several cutting-edge approaches show promise for deeper understanding of SWEET2b function:

  • Single-cell transcriptomics:

    • Reveal cell-type-specific expression patterns

    • Identify rare cell populations with unique SWEET2b functions

    • Track expression changes during development or stress responses

  • Advanced imaging techniques:

    • Super-resolution microscopy for subcellular localization

    • FRET/FLIM for protein-protein interaction studies

    • Label-free imaging for tracking sugar movements in vivo

  • Structural biology approaches:

    • Cryo-EM for high-resolution structural determination

    • Mass spectrometry for identifying post-translational modifications

    • Hydrogen-deuterium exchange for conformational dynamics

  • Systems biology integration:

    • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

    • Flux analysis to quantify sugar movement through tissues

    • Mathematical modeling of sugar transport networks

These emerging technologies will likely provide unprecedented insights into the molecular mechanisms and physiological significance of SWEET2b function in rice.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.