Recombinant Oryza sativa subsp. japonica Bidirectional sugar transporter SWEET4 (SWEET4)

Shipped with Ice Packs
In Stock

Description

Definition and Classification

Bidirectional sugar transporter SWEET4 (SWEET4) is a membrane-bound protein encoded by the SWEET4 gene in Oryza sativa subsp. japonica, commonly known as japonica rice . This protein belongs to the SWEET (Sugars Will Eventually be Exported Transporters) family, which facilitates the bidirectional transport of sugars across cellular membranes . The SWEET family in plants is known to play critical roles in various physiological processes including phloem loading, nectar secretion, pollen development, and seed filling.

SWEET4 is specifically classified as a member of the SWEET transporter family found in rice, with the systematic name OsSWEET4, indicating its origin in Oryza sativa . The protein is part of a larger network of sugar transporters that collectively regulate carbohydrate distribution throughout the plant, thereby influencing growth, development, and response to environmental conditions.

Genomic Context

The SWEET4 gene is located on chromosome 2 of the rice genome, with the locus designation Os02g0301100 and LOC_Os02g19820 . This genomic positioning is significant as it influences the gene's expression patterns and regulatory mechanisms. The gene is also known by alternative ORF (Open Reading Frame) names, including OsJ_06370 and OSJNBa0010K08.10, reflecting different annotation systems used in rice genomics .

Understanding the genomic context of SWEET4 is crucial for breeding programs and genetic modifications aimed at improving rice varieties. Rice, as one of the world's most important food crops, has undergone extensive genomic study, including complete genome sequencing of varieties such as Nipponbare, which serves as a reference genome for japonica rice .

Protein Structure and Sequence

The SWEET4 protein consists of 259 amino acids forming a membrane-spanning structure typical of transport proteins . The complete amino acid sequence of SWEET4 is:
MVSPDTIRTAIGVVGNGTALVLFLSPVPTFIRIWKKGSVEQYSAVPYVATLLNCMMWVLYGLPAVHPHSMLVITINGTGMAIELTYIALFLAFSLGAVRRRVLLLLAAEVAFVAAVAALVLNLAHTHERRSMIVGILCVLFGTGMYAAPLSVMKMVIQTKSVEYMPLFLSLASLVNGICWTAYALIRFDLYITIPNGLGVMFAVAQLILYAIYYKSTQQIIEARKRKEADHVAMTDVVVDSAKNNPSSGAAAAAANGRY

This sequence reveals characteristic features of sugar transporters, including multiple transmembrane domains that anchor the protein within the cell membrane and form the channel through which sugars are transported. The protein structure facilitates the bidirectional movement of sugars, allowing both influx into cells and efflux out of cells depending on concentration gradients and cellular requirements.

Functional Domains

While specific functional domain analysis of SWEET4 is not directly presented in the search results, research on related SWEET transporters suggests that these proteins typically contain multiple transmembrane domains connected by loop regions . These transmembrane domains create a pore through which sugar molecules can pass. The specific arrangement of these domains determines substrate specificity and transport characteristics.

Based on studies of other SWEET transporters in rice, such as SWEET11 and SWEET15, we can infer that SWEET4 likely contains domains that recognize and bind sugar molecules, particularly sucrose, which is the predominant transport sugar in rice plants .

Expression Systems and Methods

The recombinant form of SWEET4 is produced using Escherichia coli as an expression system . The full-length protein (spanning amino acids 1-259) is expressed with an N-terminal histidine tag (His-tag), which facilitates purification and detection . The His-tagged recombinant protein allows for efficient purification using affinity chromatography methods.

The production process involves cloning the SWEET4 gene sequence into suitable expression vectors, transformation of E. coli host cells, induction of protein expression, and subsequent purification steps. After expression, the protein undergoes quality control measures to ensure purity greater than 90%, as determined by SDS-PAGE analysis .

Role in Sugar Transport and Metabolism

While specific functions of SWEET4 are not directly detailed in the search results, insights can be gained from research on related SWEET transporters in rice. SWEET proteins, including SWEET4, are involved in the transport of sugars across cellular membranes . This transport is crucial for distributing carbohydrates throughout the plant for growth, development, and energy storage.

In rice, SWEET transporters such as SWEET11 and SWEET15 have been identified as key players in seed filling, facilitating the movement of sucrose from maternal tissues to developing seeds . Given the shared family characteristics, SWEET4 likely plays a role in sugar transport processes, potentially contributing to specific aspects of rice metabolism and development.

Expression Patterns and Regulation

Understanding the expression patterns of SWEET transporters provides insight into their physiological roles. Studies of SWEET11 and SWEET15 in rice have shown that these transporters are highly expressed in specific tissues related to seed development, including the nucellus, nucellar projection, nucellar epidermis, and aleurone .

These expression patterns highlight the importance of SWEET transporters in facilitating sugar movement from source tissues (where sugars are produced, typically leaves) to sink tissues (where sugars are consumed or stored, such as developing seeds) . This process is critical for rice grain development and ultimately affects yield and quality.

The regulation of SWEET transporters is complex and may involve factors such as developmental stage, environmental conditions, and hormonal signals. Mutations in SWEET transporters can significantly impact plant development, as demonstrated by the observation that knockout lines of SWEET11 and SWEET15 showed abnormal starch accumulation and defective endosperm development .

Biochemical and Functional Studies

Recombinant SWEET4 protein serves as a valuable tool for various biochemical and functional studies. Researchers can use the purified protein to investigate binding properties, transport kinetics, and interactions with other molecules. These studies contribute to our understanding of sugar transport mechanisms in plants.

In vitro assays using recombinant SWEET4 can help determine substrate specificity, identifying which sugars are preferentially transported by this protein. Such information is crucial for understanding the protein's role in rice metabolism and potential applications in crop improvement.

Antibody Production and Immunological Assays

The availability of recombinant SWEET4 protein enables the production of specific antibodies that can be used in immunological assays such as Western blotting, immunohistochemistry, and ELISA . These techniques allow researchers to detect and quantify SWEET4 protein in plant tissues, providing insights into its expression patterns and localization.

Immunological assays can help answer questions about how SWEET4 expression changes under different environmental conditions, developmental stages, or in response to stresses. This information contributes to our understanding of sugar transport regulation in rice and can inform strategies for improving crop performance.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance for arrangements and associated fees.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
SWEET4; Os02g0301100; LOC_Os02g19820; OsJ_06370; OSJNBa0010K08.10; Bidirectional sugar transporter SWEET4; OsSWEET4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-259
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
SWEET4
Target Protein Sequence
MVSPDTIRTAIGVVGNGTALVLFLSPVPTFIRIWKKGSVEQYSAVPYVATLLNCMMWVLY GLPAVHPHSMLVITINGTGMAIELTYIALFLAFSLGAVRRRVLLLLAAEVAFVAAVAALV LNLAHTHERRSMIVGILCVLFGTGMYAAPLSVMKMVIQTKSVEYMPLFLSLASLVNGICW TAYALIRFDLYITIPNGLGVMFAVAQLILYAIYYKSTQQIIEARKRKEADHVAMTDVVVD SAKNNPSSGAAAAAANGRY
Uniprot No.

Target Background

Function
This protein mediates both low-affinity uptake and efflux of sugar across the plasma membrane.
Database Links
Protein Families
SWEET sugar transporter family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is SWEET4 and how does it function in Oryza sativa?

SWEET4 (Bidirectional sugar transporter SWEET4) belongs to the SWEET (Sugars Will Eventually be Exported Transporter) family of proteins that function as bidirectional uniporters/facilitators. These transporters facilitate the diffusion of sugars across cell membranes along concentration gradients without requiring energy input. Unlike other sugar transporters such as MSTs and SUTs that couple with H+ to transport sugars in one direction, SWEET proteins can transport sugars in both directions (extracellular to intracellular and vice versa) depending on the concentration gradient. This transport mechanism is independent of pH values or proton gradients . In Oryza sativa (rice), SWEET4 plays important roles in various physiological processes including phloem loading, seed filling, and potentially in plant-pathogen interactions.

How does SWEET4 differ from other members of the SWEET family?

While all SWEET proteins function as sugar transporters, they differ in their substrate specificity, expression patterns, and physiological roles. SWEET4 is part of the SWEET clade that primarily transports hexoses (such as glucose) rather than sucrose. Unlike some other SWEET members that are predominantly expressed in specific tissues (e.g., some SWEETs are primarily expressed in nectaries or pollen), SWEET4 shows a more diverse expression pattern across various plant tissues. Additionally, while some SWEET proteins (like SWEET11 and SWEET12 in Arabidopsis) are key targets for pathogen effectors during infection, SWEET4's role in pathogen susceptibility is less characterized compared to other family members .

What are the optimal conditions for expressing recombinant SWEET4 protein?

For optimal expression of recombinant SWEET4 from Oryza sativa subsp. japonica, an E. coli expression system has been successfully employed . When expressing membrane proteins like SWEET4, consider the following optimization strategies:

  • Expression system selection: While E. coli is commonly used, plant-based expression systems may provide more appropriate post-translational modifications. Rice cell suspension cultures can be particularly advantageous for expressing rice proteins .

  • Temperature and induction conditions: Lower temperatures (16-20°C) often improve the folding of membrane proteins. Induction with lower IPTG concentrations (0.1-0.5 mM) for longer periods may increase the yield of correctly folded protein.

  • Detergent selection: For membrane protein purification, screening different detergents (DDM, LDAO, or Fos-choline derivatives) is crucial for maintaining protein stability and function.

  • Codon optimization: Adapting the SWEET4 coding sequence to the codon bias of the expression host can significantly improve expression levels.

What purification strategies are most effective for SWEET4?

Purification of membrane proteins like SWEET4 requires specialized approaches:

  • Affinity chromatography: His-tagged SWEET4 can be purified using nickel or cobalt affinity resins . A wash buffer containing low concentrations of imidazole (10-30 mM) helps reduce non-specific binding, followed by elution with higher imidazole concentrations (250-500 mM).

  • Size exclusion chromatography: This can be employed as a second purification step to separate properly folded protein from aggregates and to exchange the protein into a suitable buffer system.

  • Buffer optimization: Tris/PBS-based buffers with pH 8.0 have been used successfully for SWEET4 . Addition of stabilizers like 6% trehalose can enhance protein stability.

  • Storage conditions: The purified protein should be stored at -20°C/-80°C, with aliquoting recommended to avoid repeated freeze-thaw cycles. Lyophilized preparations generally have longer shelf life (up to 12 months) compared to liquid formulations (approximately 6 months) .

How can functional assays be designed to measure SWEET4 transport activity?

Several approaches can be used to assess SWEET4 transport function:

  • Radioactive substrate uptake assays: Using 14C-labeled sugars to monitor transport in proteoliposomes or cells expressing SWEET4.

  • Fluorescence-based assays: Employing fluorescent sugar analogs or pH-sensitive fluorescent proteins to monitor transport activity.

  • Electrophysiological methods: Patch-clamp techniques can be used to measure transport-associated currents in cells expressing SWEET4.

  • Liposome-based transport assays: Reconstituting purified SWEET4 into liposomes loaded with fluorescent indicators to measure sugar transport.

  • Yeast complementation assays: Using yeast strains deficient in specific sugar transporters to assess SWEET4 function through growth recovery experiments.

The following table summarizes key parameters for designing SWEET4 transport assays:

Assay ParameterRecommended ConditionsNotes
pH range5.5-7.5SWEET transport is less pH-dependent than proton-coupled transporters
Temperature25-30°CHigher temperatures may increase transport rates but reduce stability
Sugar concentration0.1-20 mMFor kinetic studies, use a range to determine Km and Vmax
Incubation time5-30 minutesMonitor time course to determine linear range of transport
ControlsHeat-inactivated protein; competitive inhibitorsEssential for distinguishing specific from non-specific transport

How can genetic modification approaches be used to study SWEET4 function in planta?

Several genetic approaches can be employed to investigate SWEET4 function:

  • CRISPR/Cas9-mediated gene editing: This technique can be used to create knockout or knockdown SWEET4 mutants in rice. While the search results don't specifically mention CRISPR for SWEET4, the technology has been successfully applied to other genes in plants . For SWEET4, design guide RNAs targeting conserved regions of the gene, particularly the transmembrane domains essential for transport function.

  • RNAi-mediated silencing: This approach can be used for tissue-specific or inducible silencing of SWEET4 expression, allowing the study of its function in specific developmental contexts.

  • Overexpression studies: Expressing SWEET4 under constitutive or tissue-specific promoters can reveal gain-of-function phenotypes and potential roles in sugar partitioning.

  • Promoter-reporter fusions: By fusing the SWEET4 promoter to reporter genes like GUS or GFP, the spatial and temporal expression patterns can be visualized.

  • Site-directed mutagenesis: Introducing specific mutations in conserved residues can help identify amino acids critical for substrate specificity or transport activity.

What are the challenges in crystallizing SWEET transporters and how can they be overcome?

Membrane proteins like SWEET transporters present significant challenges for structural studies:

  • Expression and purification barriers: The hydrophobic nature of transmembrane domains often leads to protein aggregation or misfolding. Strategies to overcome this include:

    • Screening multiple detergents and lipids for stabilization

    • Using fusion partners like GFP to monitor folding and stability

    • Exploring nanodiscs or lipidic cubic phase systems for membrane mimetics

  • Protein engineering approaches:

    • Creating chimeric constructs with stable membrane proteins

    • Removing flexible regions that might impede crystallization

    • Introducing mutations to increase thermostability

    • Using antibody fragments or nanobodies to stabilize specific conformations

  • Alternative structural techniques:

    • Cryo-electron microscopy, which has revolutionized membrane protein structural biology

    • Solid-state NMR for specific structural questions

    • Molecular dynamics simulations to complement experimental data

How does SWEET4 contribute to plant-pathogen interactions and stress responses?

While specific information about SWEET4's role in plant-pathogen interactions is limited in the provided search results, studies on the SWEET family provide insights:

  • Pathogen hijacking mechanisms: Many plant pathogens target SWEET transporters to manipulate host sugar transport for their benefit. Bacterial and fungal pathogens can induce SWEET expression to acquire nutrients . While SWEET4 has not been specifically identified as a major pathogen target in the search results, its sugar transport function suggests potential involvement.

  • Abiotic stress responses: SWEET transporters are involved in responses to various abiotic stresses including drought and salt stress . Under stress conditions, altered sugar partitioning may occur through regulation of SWEET transporters including SWEET4.

  • Research methodologies: To investigate SWEET4's role in stress responses:

    • Monitor SWEET4 expression under different biotic and abiotic stress conditions

    • Create SWEET4 knockout/overexpression lines and assess their stress tolerance

    • Perform co-immunoprecipitation experiments to identify interacting proteins during stress

    • Use sugar transport assays in stressed plants to determine functional changes

How has SWEET4 evolved across different rice subspecies and related grass species?

Evolutionary analysis of SWEET4 across different rice subspecies and related grasses can provide insights into its functional conservation and diversification:

  • Comparative genomics approach: Compare SWEET4 sequences from japonica and indica rice subspecies, as well as other Oryza species and related grasses. The rice genome consists of 430 Mbp across 12 chromosomes and has been well-characterized , facilitating such comparisons.

  • Evolutionary conservation: The SWEET family is evolutionarily conserved across plants, with variability in gene number and substrate specificity. Phylogenetic analysis can reveal which SWEET4 domains are most conserved, indicating functional importance.

  • Domestication signatures: Comparing SWEET4 sequences between wild and cultivated rice can reveal if this transporter was under selection during domestication, particularly if it affects traits like grain filling or stress response.

  • Research methods:

    • Sequence alignment and phylogenetic tree construction

    • Selection pressure analysis (dN/dS ratios)

    • Synteny analysis to identify chromosomal rearrangements affecting SWEET4

    • Expression pattern comparison across species

How does the substrate specificity of SWEET4 compare to other sugar transporters in plants?

SWEET4 has distinct characteristics compared to other sugar transport systems:

  • Substrate range comparison:

    • SWEET4: Primarily transports hexoses like glucose

    • Other SWEETs: Different members may specialize in transporting sucrose (e.g., SWEET11/12) or other sugars

    • SUTs (Sucrose Transporters): Specifically transport sucrose using proton-coupled mechanisms

    • MSTs (Monosaccharide Transporters): Transport various monosaccharides with different affinities

  • Transport mechanism differences:

    • SWEETs (including SWEET4): Bidirectional uniporters that facilitate diffusion along concentration gradients

    • SUTs and MSTs: Proton-coupled transporters that use H+ gradients to drive unidirectional transport

  • Experimental approaches to characterize specificity:

    • Competition assays with different sugars

    • Site-directed mutagenesis of substrate-binding residues

    • Structural modeling and docking simulations

    • Electrophysiological measurements with different substrates

What are common challenges in recombinant SWEET4 expression and how can they be addressed?

Researchers often encounter several challenges when working with recombinant SWEET4:

  • Low expression levels: Membrane proteins typically express at lower levels than soluble proteins.

    • Solution: Optimize codon usage, use strong promoters, and consider specialized expression systems such as rice cell cultures, which may be more suitable for rice proteins .

  • Protein misfolding and aggregation: Transmembrane proteins are prone to misfolding.

    • Solution: Express at lower temperatures (16-20°C), use specialized E. coli strains (C41/C43), and add folding enhancers like glycerol (5-10%) to expression media.

  • Toxicity to host cells: Overexpression of membrane proteins can disrupt host membranes.

    • Solution: Use tightly regulated expression systems and consider inducible promoters that allow precise control of expression timing.

  • Protein instability: SWEET4 may be unstable after purification.

    • Solution: Add stabilizers like trehalose (6% has been effective) , optimize buffer conditions, and avoid freeze-thaw cycles by preparing single-use aliquots.

How can researchers optimize SWEET4 functional studies in heterologous systems?

When studying SWEET4 function in heterologous systems, consider these optimization strategies:

  • System selection: Different systems offer various advantages:

    • Xenopus oocytes: Excellent for electrophysiological studies but lower throughput

    • Yeast: Good for complementation and transport assays

    • Mammalian cells: Provide complex glycosylation but more expensive

    • Proteoliposomes: Allow precise control of membrane composition

  • Construct design considerations:

    • Include appropriate tags that don't interfere with function (N-terminal tags are often preferred)

    • Consider fusion proteins that aid in membrane targeting

    • Include TEV or similar protease sites if tag removal is necessary

  • Control experiments:

    • Always include non-functional mutants as negative controls

    • Use known sugar transporters as positive controls

    • Perform transport assays with non-substrate sugars to confirm specificity

  • Data analysis approaches:

    • Use multiple methods to confirm results (e.g., both radioactive and fluorescence-based assays)

    • Apply appropriate kinetic models to transport data

    • Consider the impact of membrane composition on transport activity

What are the best practices for analyzing SWEET4 interactions with other proteins?

Understanding SWEET4's protein-protein interactions can provide insights into its regulation and function:

  • In vitro interaction methods:

    • Pull-down assays: Using purified His-tagged SWEET4 to identify interacting partners

    • Surface Plasmon Resonance (SPR): For measuring binding kinetics

    • Isothermal Titration Calorimetry (ITC): For thermodynamic characterization of interactions

  • In vivo interaction methods:

    • Yeast two-hybrid: Modified split-ubiquitin systems designed for membrane proteins

    • Bimolecular Fluorescence Complementation (BiFC): For visualizing interactions in plant cells

    • Co-immunoprecipitation: Using SWEET4-specific antibodies or epitope tags

  • Considerations for membrane protein interactions:

    • Detergent choice can significantly affect interaction detection

    • Consider using crosslinking approaches to stabilize transient interactions

    • Nanodiscs or liposomes may provide more native-like membrane environments

How might emerging technologies enhance our understanding of SWEET4 function?

Emerging technologies offer new possibilities for SWEET4 research:

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize SWEET4 localization and dynamics

    • Single-molecule tracking to observe real-time transport events

    • Correlative light and electron microscopy to link function with ultrastructure

  • High-throughput functional genomics:

    • CRISPR screens to identify genes that interact with SWEET4

    • Synthetic biology approaches to engineer SWEET4 with novel properties

    • Systems biology integration of transcriptomics, proteomics, and metabolomics data

  • Computational approaches:

    • Molecular dynamics simulations to model sugar transport mechanisms

    • Machine learning to predict substrate specificity determinants

    • Network analysis to position SWEET4 in broader sugar signaling pathways

What are the unexplored potential applications of recombinant SWEET4 in biotechnology?

While avoiding commercial applications as requested, there are several academic research applications:

  • Biosensor development: SWEET4 could be engineered as part of sugar-sensing systems in basic research.

  • Plant improvement research: Understanding SWEET4 could inform academic studies on improving crop stress tolerance and yield.

  • Structural biology platforms: SWEET4 could serve as a model system for studying membrane protein folding and stability.

  • Educational tools: Purified SWEET4 could be used in teaching labs to demonstrate membrane protein biochemistry.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.