Recombinant Oryza sativa subsp. japonica Bidirectional sugar transporter SWEET5 (SWEET5)

What is SWEET5 and what is its function in rice?

SWEET5 (also known as OsSWEET5) is a bidirectional sugar transporter protein found in Oryza sativa subsp. japonica (rice). It belongs to the SWEET family of transporters that facilitate the movement of sugars across cell membranes in plants. The protein plays a crucial role in sugar partitioning and allocation during plant development, contributing to processes such as phloem loading, seed development, and nectar secretion. Unlike unidirectional transporters, SWEET5 can transport sugars in both directions across membranes, depending on concentration gradients and plant physiological needs .

What is the molecular structure and key domains of the SWEET5 protein?

The SWEET5 protein (UniProt No: Q6L568) consists of 237 amino acids with a specific sequence that includes several transmembrane domains. The full amino acid sequence is: MVMNPDAVRNVVGIIGNLISFGLFLSPLPTFVTIVKKKDVEEFVPDPYLATFLNCALWVFYGLPFIHPNSILVVTINGTGLLIEIAYL AIYFA YAPKPKRCRMLGVLTVEL VFLAAVAAGVLLGAHTYDKRSLIVGTLCVFFGTLMYAAPLTIMKQVIATKSVEYMPFTLSLVSFINGICWTIYAFIRFDILITIPNGMGTLLGAAQLILYFCYYDGSTAKNKGALELPKDGDSSAV . SWEET transporters typically contain seven transmembrane domains organized in a "3+1+3" configuration, forming a pore through which sugars are transported. The conserved regions are critical for substrate recognition and transport function.

How does the SWEET family of transporters differ from other sugar transport mechanisms in plants?

The SWEET family represents a distinct class of sugar transporters that differs from other plant sugar transport systems in several key aspects:

This distinctive transport mechanism makes SWEET proteins particularly important for processes requiring bidirectional sugar movement across membranes, such as nectar secretion, pollen development, and seed filling.

What are the optimal storage conditions for recombinant SWEET5 protein?

For optimal stability and activity retention, recombinant SWEET5 protein should be stored according to specific guidelines. The shelf life is influenced by multiple factors including buffer composition, storage temperature, and the protein's inherent stability. Generally, liquid formulations have a shelf life of approximately 6 months when stored at -20°C/-80°C, while lyophilized forms can remain stable for up to 12 months at the same temperatures . For working solutions, it's recommended to prepare small aliquots to avoid repeated freeze-thaw cycles, which can significantly compromise protein integrity. Working aliquots should be stored at 4°C and used within one week .

How should recombinant SWEET5 protein be reconstituted for experimental use?

For proper reconstitution of lyophilized recombinant SWEET5 protein:

• Briefly centrifuge the vial before opening to ensure all material is at the bottom

• Reconstitute the protein in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (with 50% being optimal for long-term storage)

• Prepare small aliquots to minimize freeze-thaw cycles

• Store reconstituted protein at -20°C/-80°C for long-term use

This protocol ensures maximum retention of protein activity for subsequent experimental applications.

What expression systems are most effective for producing recombinant SWEET5?

The baculovirus expression system has proven particularly effective for producing functional recombinant SWEET5 protein . This eukaryotic expression system offers several advantages for membrane protein production:

• Proper post-translational modifications

• Correct protein folding and membrane insertion

• Higher protein yields compared to bacterial systems

• Reduced formation of inclusion bodies

Other expression systems that might be suitable include yeast systems (Pichia pastoris) for smaller-scale production and mammalian cell cultures for specialized applications requiring specific glycosylation patterns. Each system presents tradeoffs between yield, functionality, and authentic post-translational modifications that should be considered based on research requirements.

What methods are most effective for studying SWEET5 transport activity in vitro?

For rigorous characterization of SWEET5 transport activity in vitro, researchers can employ several complementary approaches:

• Liposome-based transport assays: Reconstitution of purified SWEET5 into liposomes loaded with fluorescent sugar analogs allows real-time monitoring of transport activity through changes in fluorescence intensity.

• Electrophysiological techniques: Two-electrode voltage clamp (TEVC) recordings in Xenopus oocytes expressing SWEET5 can measure sugar-induced currents, providing insights into transport kinetics and substrate specificity.

• Radiolabeled substrate uptake: Measuring the accumulation of radiolabeled sugars in proteoliposomes or expression systems containing SWEET5 can quantify transport rates and substrate preferences.

• Fluorescence resonance energy transfer (FRET) sensors: Genetically encoded FRET sensors can detect conformational changes during the transport cycle when fused to SWEET5.

These methodologies provide complementary data on transport directionality, substrate specificity, and transport kinetics that collectively offer a comprehensive functional profile of SWEET5.

How can researchers determine the substrate specificity of SWEET5?

Determining substrate specificity of SWEET5 requires systematic testing of different sugars and sugar analogs through multiple experimental approaches:

• Competition assays: Using a known transported sugar (e.g., labeled glucose) and adding potential unlabeled substrates as competitors. Decreased transport of the labeled substrate indicates competition for the same binding site.

• Direct transport measurements: Quantifying transport rates for different substrates using radioisotope-labeled sugars or enzymatic assays to detect transported sugars.

• Binding assays: Employing techniques like isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR) to measure binding affinities for different sugars.

• Molecular docking and simulation: Computational modeling of substrate interactions with the SWEET5 binding pocket can predict potential substrates before experimental validation.

A comprehensive substrate specificity profile should include testing of common plant sugars (glucose, fructose, sucrose, maltose) and potentially sugar alcohols at physiologically relevant concentrations, preferably across different pH values to reflect various cellular compartments.

What experimental approaches can differentiate SWEET5 function from other SWEET family members?

Distinguishing the specific functions of SWEET5 from other SWEET family members requires multi-faceted experimental approaches:

• Gene-specific knockdown/knockout: CRISPR-Cas9 or RNAi-mediated silencing of SWEET5 specifically, followed by phenotypic and metabolomic analyses.

• Promoter-reporter fusion studies: Analyzing tissue-specific and developmental expression patterns using SWEET5 promoter-GUS or GFP fusions to identify unique expression domains.

• Complementation experiments: Expressing SWEET5 in mutants lacking other SWEET transporters to assess functional redundancy or specialization.

• Subcellular localization: Immunolocalization or fluorescent protein fusions to determine precise membrane localization that may differ from other family members.

• Heterologous expression: Expressing SWEET5 in yeast mutants lacking endogenous sugar transporters can reveal unique transport characteristics compared to other SWEET proteins expressed in the same system.

This comprehensive approach helps establish the unique physiological roles of SWEET5 within the broader context of sugar transport in rice.

How does the promoter sequence affect SWEET5 expression in different rice varieties?

Research on related transporters provides insights into how promoter variations might affect SWEET5 expression. Similar to findings with OsNRAMP5, sequence variations in the promoter region can significantly alter transcript levels and resulting phenotypes . When examining different rice varieties, researchers identified distinct haplotypes based on promoter sequences that correlated with expression levels and phenotypic outcomes.

For studying SWEET5 promoter activity:

• Isolate and sequence the 2-kb 5′-flanking regions from different rice varieties

• Classify promoter haplotypes based on sequence variations

• Quantify expression levels using qRT-PCR

• Assess promoter strength through transient expression assays in rice protoplasts using reporter genes like GFP or GUS

• Correlate promoter variations with phenotypic differences in sugar transport or accumulation

Promoter-swap experiments between varieties with different expression levels can confirm the causal relationship between promoter sequence and expression strength. For example, a method similar to that used for OsNRAMP5 could be adapted, where "The green fluorescent signals of GFP driven by the PA64s promoter were stronger than those driven by the 93–11 promoter, and the GUS transcript levels driven by the PA64s promoter also showed a higher level compared to that driven by the 93–11 promoter" .

What is the role of SWEET5 in plant-pathogen interactions and how can it be studied?

While the search results don't directly address SWEET5's role in plant-pathogen interactions, several SWEET family members are known targets of pathogen effectors that manipulate sugar transport to the apoplast to support pathogen growth. To investigate SWEET5's potential involvement:

• Infection studies: Monitor SWEET5 expression changes during infection with various rice pathogens using qRT-PCR and RNA-seq

• Promoter analysis: Examine the SWEET5 promoter for pathogen-responsive elements and potential binding sites for pathogen effectors

• Genetic approaches: Generate SWEET5 overexpression and knockout lines to assess changes in disease susceptibility

• Protein-protein interaction studies: Use yeast two-hybrid or co-immunoprecipitation to identify interactions between SWEET5 and pathogen effectors

• Sugar flux measurements: Quantify apoplastic sugar content during infection in wild-type vs. SWEET5 mutant plants

These approaches would help determine whether SWEET5, like some other SWEET transporters, plays a role in pathogen susceptibility by facilitating sugar leakage to the apoplast during infection.

How can SWEET5 be targeted for crop improvement applications?

SWEET5 could be targeted for rice improvement through several biotechnological approaches:

• SWEET5 overexpression: Similar to the approach used for OsNRAMP5 , overexpressing SWEET5 under appropriate promoters could enhance sugar translocation to developing seeds, potentially increasing yield or grain quality.

• Promoter engineering: Modifying the native promoter or replacing it with tissue-specific or inducible promoters could optimize sugar transport to specific tissues at critical developmental stages.

• CRISPR-Cas9 editing: Precise genome editing could modify key regulatory elements in the SWEET5 promoter or coding sequence to alter expression patterns or transport kinetics.

• Allele mining and selection: Identifying naturally occurring high-performing SWEET5 alleles from diverse rice germplasm could inform marker-assisted selection for improved sugar translocation.

• Gene stacking: Combining optimized SWEET5 alleles with other sugar metabolism genes could create synergistic effects on carbohydrate partitioning and yield.

These strategies should be evaluated not only for their effects on yield and quality but also for potential tradeoffs in stress tolerance or disease susceptibility, as altered sugar transport dynamics may affect multiple physiological processes.

What are the most effective methods for cloning and expressing recombinant SWEET5?

Based on methodologies used for similar transporters, an effective protocol for cloning and expressing recombinant SWEET5 would include:

Cloning strategy:

• Amplify the SWEET5 cDNA using RNA from appropriate rice tissues with primers containing suitable restriction sites (e.g., KpnI and XbaI)

• Clone the amplified fragment into an expression vector (e.g., pCAMBIA1300S for plant expression or suitable vectors for heterologous systems)

• Verify the construct by sequencing before transformation

Expression systems:

• Plant expression: Agrobacterium-mediated transformation for rice overexpression studies

• Heterologous expression: Baculovirus system for protein production, or yeast/Xenopus oocytes for functional studies

A methodology similar to that described for OsNRAMP5 could be adapted: "The cDNA was amplified by PCR with forward and reverse primers which include restriction sites. The amplified fragment was cloned into a vector for overexpression. The constructed vector was sequenced and introduced into rice by Agrobacterium tumefaciens-mediated transformation" .

What are common challenges in purifying functional SWEET5 protein and how can they be addressed?

Membrane proteins like SWEET5 present specific purification challenges:

Including 50% glycerol in storage buffers and maintaining strict temperature control can significantly improve stability, as recommended for recombinant SWEET5 . Additionally, rapid processing and minimizing freeze-thaw cycles are critical for maintaining functional integrity.

How can researchers validate antibody specificity for SWEET5 in immunological studies?

Ensuring antibody specificity for SWEET5 is crucial for reliable results in immunodetection experiments. A comprehensive validation protocol should include:

• Western blot analysis using:

  • Recombinant SWEET5 protein as a positive control

  • Protein extracts from SWEET5 knockout/knockdown plants as negative controls

  • Protein extracts from SWEET5 overexpression lines to confirm signal increase

• Pre-absorption controls: Pre-incubate antibodies with purified recombinant SWEET5 before immunostaining to demonstrate signal reduction

• Peptide competition assays: Compare antibody binding with and without competing peptides corresponding to the antibody epitope

• Cross-reactivity assessment: Test antibody against closely related SWEET family members to ensure specificity

• Immunoprecipitation followed by mass spectrometry: Confirm that the antibody pulls down SWEET5 and not other proteins

• Comparative analysis across antibodies: If possible, validate findings using multiple antibodies targeting different epitopes of SWEET5

These validation steps ensure that observed signals in immunological studies truly represent SWEET5 protein and not related transporters or non-specific binding.

How does rice SWEET5 compare structurally and functionally to SWEET transporters in other plant species?

A comparative analysis reveals both conserved features and species-specific adaptations in SWEET transporters:

SWEET proteins are generally divided into four clades based on phylogenetic relationships, with different clades showing preferences for certain substrates (e.g., hexoses vs. sucrose). Functional studies of orthologous SWEET transporters across species could reveal evolutionary adaptation to different metabolic needs and environmental conditions across plant lineages.

What can mutational analysis reveal about structure-function relationships in SWEET5?

Systematic mutational analysis can provide crucial insights into SWEET5 structure-function relationships:

• Transmembrane domain mutations: Altering conserved residues in transmembrane domains can identify amino acids essential for pore formation and sugar recognition

• Extracellular/intracellular loop mutations: Modifications to connecting loops can reveal their roles in conformational changes during transport cycles

• Site-directed mutagenesis of conserved motifs: Targeting evolutionarily conserved sequences shared across SWEET transporters can identify functional motifs

• Chimeric protein analysis: Creating chimeras between SWEET5 and other SWEET transporters can map domains responsible for substrate specificity and transport efficiency

• Cysteine-scanning mutagenesis: Systematic replacement of residues with cysteine followed by accessibility studies can map the protein topology and identify pore-lining residues

Functional assays following mutagenesis should include transport assays, localization studies, and protein stability assessments to comprehensively characterize the effects of specific mutations.

How do environmental factors modulate SWEET5 expression and activity in rice?

Environmental factors likely influence SWEET5 expression and activity through complex regulatory networks:

• Sugar availability: Feedback regulation may occur where changes in cellular sugar levels affect SWEET5 expression

• Abiotic stress responses: Drought, salinity, and temperature extremes may alter SWEET5 expression as part of adaptive carbohydrate partitioning

• Developmental cues: Expression patterns likely change during key developmental transitions, particularly during reproductive development and grain filling

• Diurnal patterns: Day/night cycles may influence expression patterns in coordination with photosynthetic activity

• Hormonal regulation: Plant hormones such as auxin, abscisic acid, and gibberellins may modulate SWEET5 expression

Experimental approaches to study these regulatory mechanisms include:

• Transcriptional analysis under various environmental conditions

• Promoter-reporter studies to identify condition-specific enhancers/silencers

• Chromatin immunoprecipitation to identify transcription factors binding to the SWEET5 promoter

• Metabolomic analysis correlated with expression data to identify metabolite-based feedback mechanisms

Understanding these regulatory networks could inform strategies to optimize SWEET5 activity under varying environmental conditions for improved crop performance.