Recombinant Oryza sativa subsp. japonica Bidirectional sugar transporter SWEET6b (SWEET6B)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Expression

The SWEET6B gene is located on chromosome 1 (Os01g0605700) and encodes a protein-coding sequence . Recombinant SWEET6B is commercially available for research (e.g., MyBioSource catalog #MBS20352161, priced at $1,550) .

Table 2: Expression and Availability

ParameterDetail
Recombinant SourceExpressed in heterologous systems (e.g., HEK293T, yeast)
Antibodies AvailableRabbit polyclonal antibodies for ELISA/WB (targeting indica/japonica)
Functional AssaysYeast complementation, HEK293T fluorescence transport assays

Functional Roles in Rice Physiology

SWEET6B contributes to:

  • Carbon Remobilization: Upregulated under methyl jasmonate (MeJA) treatment to enhance sugar transport during grain filling .

  • Stress Responses: Methylation changes in SWEET6b correlate with altered sucrose efflux under abiotic stress .

  • Phloem Loading: Likely cooperates with other SWEETs (e.g., SWEET11/12) for apoplastic sucrose transport .

Key Mutational Studies

  • Y57A/G58D Mutations: Disrupt oligomerization, abolishing transport activity .

  • N76A/S176A/W180A: Eliminate sucrose binding, confirming TM3/TM6 residues’ role in substrate recognition .

Regulatory Mechanisms

  • Epigenetic Regulation: Hypermethylation under drought stress enhances SWEET6b expression, promoting starch-to-sugar conversion .

  • Transcriptional Control: Coexpressed with TFs (e.g., MYBS2-like, ERF24) linked to carbon signaling .

Biotechnological Applications

  • Metabolic Engineering: SWEET6B could optimize sucrose partitioning in biofuel crops .

  • Pathogen Resistance: SWEET transporters are hijacked by pathogens; engineering SWEET6B may enhance disease resistance .

Comparative Analysis with Other SWEETs

Table 3: SWEET6B vs. Other Plant SWEET Transporters

FeatureSWEET6BAtSWEET1 (Arabidopsis)OsSWEET11 (Rice)
SubstrateSucroseGlucoseSucrose
Key ResiduesTrp58, Asn76, Trp180Tyr57, Gly58Asn54, Trp58
Expression SiteVascular tissue, stemsPhloem companion cellsPhloem parenchyma
RoleCarbon remobilizationHexose effluxSucrose loading

Outstanding Questions

  • Does SWEET6B form heterooligomers with other SWEETs?

  • How does methylation dynamically regulate SWEET6b expression?

  • Can SWEET6B transport non-sugar metabolites (e.g., phytohormones)?

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, briefly centrifuge the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
SWEET6B; Os01g0605700; LOC_Os01g42090; OsJ_02536; P0681B11.45; P0704D04.1; Bidirectional sugar transporter SWEET6b; OsSWEET6b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-254
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
SWEET6B
Target Protein Sequence
MISPDAARNVVGIIGNVISFGLFLSPVPTFWRICKRKDVEQFKADPYLATLLNCMLWVFY GIPIVHPNSILVVTINGIGLIVEGTYLFIFFLYSPNKKRLRMLAVLGVELVFMLAVILGV LLSAHTHKKRSMIVGILCVFFGSIMYFSPLTIMGKVIKTKSVEYMPFFLSLVCFLNGVCW TAYALIRFDIYVTIPNGLGAIFGAIQLILYACYYRTTPKKTKAAKDVEMPSVISGPGAAA TASGGSVVSVTVER
Uniprot No.

Target Background

Function
This protein mediates both low-affinity uptake and efflux of sugar across the plasma membrane.
Database Links

KEGG: osa:4324213

UniGene: Os.33697

Protein Families
SWEET sugar transporter family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is SWEET6b and how does it function in plant cells?

SWEET6b (Bidirectional sugar transporter SWEET6b) is a member of the SWEET family of sugar transporters found in Oryza sativa subsp. japonica (rice). As part of the SWEET (sugars will eventually be exported transporter) family, SWEET6b functions as a bidirectional uniporter/facilitator that enables the diffusion of sugars across cell membranes along concentration gradients . Unlike other sugar transporters that rely on proton gradients, SWEET proteins like SWEET6b use the concentration gradient of intracellular and extracellular sugars to transport them across membranes .

The primary function of SWEET6b involves facilitating sugar movement in both directions (import or export) depending on the relative sugar concentrations inside and outside the cell. This bidirectional transport capability plays crucial roles in various physiological processes including phloem loading for long-distance sugar transport, pollen nutrition, nectar secretion, seed filling, and responses to both biotic and abiotic stresses .

How does the structure of SWEET6b contribute to its transport function?

SWEET proteins like SWEET6b possess a unique structural arrangement that enables their bidirectional transport function. While the specific crystal structure of SWEET6b has not been fully resolved, insights from related SWEET proteins reveal critical structural elements:

  • SWEET proteins contain approximately 7 transmembrane (TM) domains organized into two triple-helix bundles (THB1 and THB2) connected by TM4

  • The co-expression of THB1+TM4 and THB2 enables glucose transportation, while truncated versions (THB1 and TM4+THB2) cannot transport glucose

  • Key residues necessary for transport function include:

    • Cysteine residues from TM2

    • Asparagine residues from TM3 and TM7

    • Phenylalanine residues from TM6

Based on structural analysis of related SWEETs, the protein likely transitions between three conformational states: outward open, inward open, and occluded. This enables a "rocking-type motion" that facilitates sugar transport across the membrane .

What are the alternative identifiers and nomenclature for SWEET6b?

When searching databases or literature for SWEET6b, researchers should be aware of all alternative identifiers to ensure comprehensive results:

Identifier TypeName/ID
Primary Gene NameSWEET6B
Alternative Gene NamesLOC4324213, MtN3-like, OsJ_02536, OsSWEET6b
Genomic IdentifiersP0704D04.1
Protein NameBidirectional sugar transporter SWEET6b

These multiple identifiers reflect the evolution of nomenclature as the gene was discovered, characterized, and incorporated into various genomic databases .

What expression systems are most effective for recombinant SWEET6b production?

For the recombinant production of SWEET6b, several expression systems can be employed, each with advantages for specific experimental applications:

  • Cell-Free Expression Systems: Based on available recombinant products, cell-free expression systems have been successfully used for SWEET6b production . These systems offer advantages for membrane proteins by:

    • Eliminating cellular toxicity concerns that often occur with membrane protein overexpression

    • Allowing direct incorporation into artificial membrane environments

    • Providing rapid protein production without cell culture

  • Methodology for Cell-Free Expression:

    • Prepare template DNA containing SWEET6b coding sequence with appropriate regulatory elements

    • Combine with cell-free extract containing transcription/translation machinery

    • Add necessary cofactors and membrane mimetics (liposomes, nanodiscs, or detergents)

    • Incubate at optimal temperature (typically 30°C) for 2-4 hours

    • Purify using affinity chromatography if a tag was incorporated

For quality control of the expressed protein, SDS-PAGE analysis should confirm a purity of ≥85% . Western blotting using specific antibodies can verify protein identity.

How can researchers design experiments to measure SWEET6b transport activity?

To effectively measure SWEET6b transport activity, researchers should follow these methodological approaches:

  • In vitro transport assays:

    • Reconstitute purified SWEET6b into proteoliposomes

    • Load liposomes with or without sugars to create concentration gradients

    • Measure sugar uptake/efflux using radioisotope-labeled sugars or fluorescent sugar analogs

    • Use stopped-flow fluorescence spectroscopy to measure transport kinetics in real-time

  • Experimental design considerations:

    • Include negative controls (proteoliposomes without SWEET6b)

    • Test multiple sugar substrates to determine specificity

    • Vary sugar concentrations to determine kinetic parameters (Km, Vmax)

    • Evaluate pH-dependence by varying buffer conditions

    • Assess effects of potential inhibitors

  • Data analysis approach:

    • Calculate initial transport rates from linear portion of uptake/efflux curves

    • Use Michaelis-Menten equations to determine kinetic parameters

    • Compare transport rates across different experimental conditions using appropriate statistical tests

A robust experimental design should include multiple technical and biological replicates with appropriate controls to account for variation in proteoliposome preparation and protein incorporation efficiency .

What antibody-based methods can be used to study SWEET6b expression and localization?

Antibody-based approaches are valuable for studying SWEET6b expression, localization, and protein interactions:

  • Available antibodies:
    Commercial polyclonal antibodies against SWEET6b are available, such as Rabbit anti-Oryza sativa subsp. japonica SWEET6B . These antibodies are typically purified using antigen-affinity methods.

  • Applications and methodological approaches:

    a) Western Blotting:

    • Extract total protein from plant tissues using appropriate buffer systems

    • Separate proteins by SDS-PAGE and transfer to membrane

    • Block membrane and incubate with anti-SWEET6b primary antibody

    • Detect using appropriate secondary antibody and visualization system

    • Expected result: Band at approximately the predicted molecular weight of SWEET6b

    b) Immunolocalization:

    • Prepare tissue sections or protoplasts from rice tissues

    • Fix samples with paraformaldehyde

    • Permeabilize and block non-specific binding

    • Incubate with anti-SWEET6b primary antibody followed by fluorophore-conjugated secondary antibody

    • Counterstain with membrane markers and visualize using confocal microscopy

    • Controls should include sections without primary antibody and preimmune serum controls

    c) Co-immunoprecipitation:

    • Solubilize membranes containing SWEET6b using mild detergents

    • Incubate with anti-SWEET6b antibody

    • Precipitate using protein A/G beads

    • Analyze precipitated proteins by mass spectrometry to identify interaction partners

When interpreting results, researchers should be aware of potential cross-reactivity with other SWEET family members due to sequence similarity .

How does SWEET6b contribute to sugar transport and phloem loading in rice?

The role of SWEET6b in rice sugar transport must be understood within the broader context of SWEET transporters in phloem loading:

SWEET proteins are crucial for phloem loading in plants, as demonstrated by studies on AtSWEET11 and AtSWEET12 in Arabidopsis, which are located on phloem parenchyma plasma membranes . In rice, OsSWEET11 (a homolog of AtSWEET11) has been identified as playing a key role in this process .

To investigate SWEET6b's specific contribution to sugar transport and phloem loading in rice, researchers should employ these methodological approaches:

  • Expression pattern analysis:

    • Perform tissue-specific qRT-PCR to quantify SWEET6b expression in various rice tissues

    • Create promoter-reporter fusions (SWEET6b promoter driving GFP) to visualize expression patterns

    • Use in situ hybridization to precisely locate SWEET6b transcripts in phloem-associated cells

  • Transport specificity determination:

    • Express SWEET6b in heterologous systems (yeast, oocytes) to test transport of different sugars

    • Compare transport rates of glucose, fructose, sucrose, and other potential substrates

    • Determine kinetic parameters for each substrate

  • Functional analysis in planta:

    • Generate SWEET6b knockout/knockdown rice plants using CRISPR-Cas9 or RNAi

    • Analyze sugar content in different tissues (source leaves, sink tissues, phloem sap)

    • Measure photosynthetic rates and carbon partitioning using 14C-labeling studies

    • Examine plant development and yield components under various growing conditions

When interpreting results, it's important to consider potential functional redundancy with other SWEET transporters that may compensate for the loss of SWEET6b function .

What role does SWEET6b play in plant-pathogen interactions?

SWEET transporters are known to be involved in plant-pathogen interactions, with some bacterial pathogens manipulating host SWEET genes to enhance sugar efflux and create a more favorable environment for pathogen growth . To investigate SWEET6b's potential role in these interactions:

  • Pathogen response analysis:

    • Monitor SWEET6b expression changes during infection with various rice pathogens

    • Identify potential pathogen effectors that might target SWEET6b promoter regions

    • Perform chromatin immunoprecipitation to detect direct binding of transcription factors to the SWEET6b promoter during infection

  • Functional studies:

    • Challenge SWEET6b knockout/overexpression lines with rice pathogens

    • Quantify disease progression, pathogen multiplication, and sugar levels at infection sites

    • Analyze sugar content in apoplastic fluid of infected tissues

  • Promoter analysis:

    • Identify potential pathogen-responsive elements in the SWEET6b promoter

    • Create promoter-reporter constructs with targeted mutations to validate functional elements

    • Test if known bacterial TAL effectors can activate SWEET6b expression

A comprehensive experimental design would include multiple rice varieties with different disease resistance levels to determine if SWEET6b regulation correlates with susceptibility or resistance to specific pathogens .

How can CRISPR-Cas9 genome editing be optimized for studying SWEET6b function?

CRISPR-Cas9 technology offers powerful approaches for investigating SWEET6b function through precise genome editing:

  • Guide RNA design optimization:

    • Target multiple sites within SWEET6b coding sequence, prioritizing early exons

    • Design at least 3-4 independent guide RNAs using tools that predict off-target effects

    • Suggested target sites should include conserved regions encoding functionally important domains (THB1, THB2, and TM4)

    • Validate guide RNA efficiency using in vitro cleavage assays

  • Delivery methods for rice transformation:

    • Agrobacterium-mediated transformation of embryogenic callus (most common)

    • Biolistic particle delivery for recalcitrant varieties

    • Protoplast transformation for transient expression studies

  • Editing strategy options:

    • Complete knockout: Target early exons to create frameshift mutations

    • Domain-specific mutations: Target specific residues known to be important for sugar binding or transport

    • Promoter editing: Modify cis-regulatory elements to alter expression patterns

    • Epitope tagging: Insert reporter tags for protein localization studies

  • Screening and validation approaches:

    • PCR-based genotyping followed by sequencing to identify mutations

    • T7 endonuclease I assay for rapid mutation detection

    • Western blotting to confirm protein absence/alteration

    • Transport assays using protoplasts to verify functional changes

When designing CRISPR experiments, researchers should consider potential functional redundancy with other SWEET family members and plan for the creation of higher-order mutants if necessary .

How does SWEET6b compare to homologous proteins in other plant species?

Comparative analysis of SWEET6b with homologs from other plant species provides valuable insights into functional conservation and specialization:

  • Phylogenetic analysis approach:

    • Collect SWEET protein sequences from diverse plant species

    • Align sequences using tools like MUSCLE or CLUSTALW with parameters optimized for membrane proteins

    • Construct phylogenetic trees using maximum likelihood or Bayesian methods

    • Identify clades and evolutionary relationships

  • Key structural comparisons:

    • Analyze conservation of key functional residues:

      • Compare conservation of cysteine residues in TM2, asparagine residues in TM3 and TM7, and phenylalanine residues in TM6

      • Evaluate conservation of substrate-binding residues identified in AtSWEET13 (Ser20, Leu23, Asn54, Trp58, etc.)

    • Assess transmembrane domain organization and predicted 3D structures

  • Expression pattern comparison:

    • Compare tissue-specific expression patterns of SWEET6b homologs across species

    • Analyze promoter regions for conserved regulatory elements

    • Correlate expression patterns with physiological roles in different plant species

SpeciesClosest SWEET6b HomologKey Conserved DomainsPredicted Substrate Specificity
Arabidopsis thalianaAtSWEET6THB1, THB2, TM4Glucose
Zea mays (maize)ZmSWEET6THB1, THB2, TM4Glucose
Triticum aestivum (wheat)TaSWEET6THB1, THB2, TM4Glucose

Researchers should note that while structural features are often conserved, the precise physiological roles of SWEET transporters can differ significantly between species based on their expression patterns and regulation .

What data analysis approaches should be used when investigating SWEET6b transport kinetics?

Rigorous data analysis is essential when characterizing SWEET6b transport kinetics to ensure accurate interpretation:

  • Kinetic parameter determination:

    • For concentration-dependent transport assays:

      • Plot initial transport rates against substrate concentrations

      • Fit data to Michaelis-Menten equation: V = Vmax × [S] / (Km + [S])

      • Determine Km (substrate concentration at half-maximal transport rate) and Vmax (maximal transport rate)

    • For time-course experiments:

      • Calculate initial rates from the linear portion of the uptake curve

      • Use non-linear regression for later time points that show saturation

  • Statistical analysis requirements:

    • Perform experiments with at least 3-5 biological replicates

    • Calculate means, standard deviations, and standard errors

    • Apply appropriate statistical tests:

      • t-tests for comparing two conditions

      • ANOVA followed by post-hoc tests for multiple comparisons

      • Non-parametric alternatives when data violates assumptions of parametric tests

  • Addressing transport data challenges:

    • Correct for non-specific binding/uptake using appropriate controls

    • Account for differences in protein expression levels between samples

    • Consider the effects of membrane potential and pH on transport rates

    • Use Eadie-Hofstee or Lineweaver-Burk plots to identify potential deviations from Michaelis-Menten kinetics

  • Data visualization best practices:

    • Present raw data points alongside fitted curves

    • Use clear axis labels with units

    • Include error bars representing standard deviation or standard error

    • Indicate statistical significance on graphs

When comparing SWEET6b transport activity across experimental conditions or with other SWEET transporters, researchers should ensure comparable protein expression levels and experimental conditions for valid comparisons .

How can researchers address experimental challenges in SWEET6b functional studies?

Researchers investigating SWEET6b function often encounter specific technical challenges that require systematic troubleshooting approaches:

  • Low protein expression issues:

    • Optimize codon usage for expression system

    • Test different affinity tags (His, FLAG, GST) and tag positions (N-terminal vs. C-terminal)

    • Employ specialized detergents for membrane protein solubilization

    • Consider fusion partners that enhance membrane protein expression

  • Inconsistent transport assay results:

    • Standardize proteoliposome preparation methods

    • Quantify actual protein incorporation into liposomes

    • Control for liposome size distribution and integrity

    • Maintain consistent internal and external buffer compositions

    • Include ionophores to eliminate potential ion gradient effects

  • Phenotyping challenges in mutant plants:

    • Design experiments to test specific hypotheses about SWEET6b function

    • Consider developmental timing of measurements

    • Evaluate multiple growth conditions to reveal conditional phenotypes

    • Examine subtle phenotypes such as changes in sugar composition rather than gross morphological changes

    • Account for environmental variables that might mask phenotypes

  • Addressing functional redundancy:

    • Generate higher-order mutants with multiple SWEET genes disrupted

    • Use inducible or tissue-specific knockout approaches

    • Perform complementation studies with site-specific mutations to confirm causality

    • Design experiments that can detect partial loss-of-function phenotypes

When reporting results, researchers should fully document troubleshooting steps and experimental conditions to allow others to reproduce the work and build upon the findings .

How can contradictory results in SWEET6b studies be reconciled?

When faced with contradictory results in SWEET6b research, a systematic approach to reconciliation is essential:

  • Methodological differences analysis:

    • Compare experimental systems used (heterologous expression systems, in vitro assays, in planta studies)

    • Evaluate differences in protein constructs (full-length vs. truncated, tag positions, mutations)

    • Assess transport assay conditions (pH, temperature, membrane composition)

    • Consider genetic background differences in plant studies

  • Experimental validation approach:

    • Reproduce key experiments using standardized protocols

    • Perform side-by-side comparisons of different methodologies

    • Introduce controlled variables to identify factors causing discrepancies

    • Use complementary approaches to verify key findings

  • Integrate contradictory data through meta-analysis:

    • Compile results from multiple studies with detailed methodological documentation

    • Weight evidence based on experimental rigor and reproducibility

    • Identify patterns that might explain divergent results

    • Develop testable hypotheses to resolve contradictions

  • Collaborative resolution strategies:

    • Establish collaborations between labs with conflicting results

    • Exchange materials (constructs, antibodies, plant lines)

    • Standardize protocols across research groups

    • Design decisive experiments jointly

Researchers should recognize that apparent contradictions often reflect different aspects of complex biological systems rather than errors, and that such contradictions can drive important new discoveries about SWEET6b function and regulation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.