Recombinant Oryza sativa subsp. japonica Bidirectional sugar transporter SWEET7b (SWEET7B)

Shipped with Ice Packs
In Stock

Description

Functional Role in Sugar Transport

SWEET7B primarily mediates sucrose transport, though it may also interact with hexoses . Unlike proton-coupled symporters, SWEETs function as passive uniporters, enabling efflux or influx depending on cellular demand .

Substrate Specificity:

SubstrateTransport EfficiencyInhibitorsNotesSource
SucroseHighNone reportedPrimary substrate
GlucoseModerateCompetitive sugarsSecondary role
FructoseLowNot characterizedPotential under specific conditions

SWEET7B’s activity is vital during rice reproductive stages, particularly in pollen nutrition and seed development . Disruption of SWEET7B and its paralogs (e.g., OsSWEET11a) leads to sterility in double mutants, underscoring its redundancy in sucrose allocation .

Pathogen Susceptibility

SWEET7B is implicated in bacterial leaf blight (BLB) susceptibility. Xanthomonas oryzae pathogens exploit SWEET transporters by secreting transcription activator-like effectors (TALes) to induce their expression, causing sugar leakage from host cells . Engineering SWEET7B knockout lines reduces BLB susceptibility without compromising fertility, highlighting its dual role in development and defense .

Biotechnological Relevance

Recombinant SWEET7B is produced in heterologous systems (e.g., E. coli or yeast) for functional studies. Its ELISA-ready formulation enables high-throughput screening for inhibitors or modulators of sugar transport .

Comparative Analysis with Other SWEETs

FeatureSWEET7BOsSWEET14AtSWEET1 (Arabidopsis)
SubstrateSucrose, GlucoseSucroseGlucose
LocalizationPlasma membraneVacuolar membranePlasma membrane
Role in ImmunityBLB susceptibilityBLB susceptibilityNone reported
Mutant PhenotypeSterile in double mutantsReduced seed fillingHexose transport defect
Sources:

Future Directions

Research gaps include elucidating SWEET7B’s interaction with phytohormones (e.g., gibberellins) and engineering CRISPR-edited variants for disease-resistant rice cultivars . Advances in cryo-EM could further resolve its transport mechanism at atomic resolution .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference when placing the order. We will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, temperature, and protein stability. Generally, the shelf life for liquid form is 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us and we will prioritize its development.
Synonyms
SWEET7B; Os09g0258700; LOC_Os09g08440; Bidirectional sugar transporter SWEET7b; OsSWEET7b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
SWEET7B
Target Protein Sequence
MVSPDLIRNMVGIVGNIISFGLFLSPVPTFYRIIKNKDVQDFKADPYLATLLNCMLWVFY GLPIVHPNSILVVTINGIGLVIEAVYLTIFFLFSDKKNKKKMGVVLATEALFMAAVVLGV LLGAHTHQRRSLIVGILCVIFGTIMYSSPLTIMSQVVKTKSVEYMPLLLSVVSFLNGLCW TSYALIRLDIFITIPNGLGVLFALMQLILYAIYYRTIPKKQDKNLELPTVAPVAKDTSIV TPVSKDDDVDGGNASHVTINITIEL
Uniprot No.

Target Background

Function
This protein acts as a bidirectional sugar transporter, facilitating both low-affinity uptake and efflux of sugar across the plasma membrane.
Database Links

KEGG: osa:4346541

Protein Families
SWEET sugar transporter family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is SWEET7b and what is its functional role in rice?

SWEET7b (Bidirectional sugar transporter SWEET7b) is a membrane protein belonging to the SWEET family of sugar transporters found in rice (Oryza sativa). It functions as a bidirectional sugar transporter, facilitating the movement of sugars across cellular membranes. The full-length protein consists of 265-266 amino acids and plays a critical role in carbohydrate allocation within the plant . As a member of the SWEET family, it likely contributes to processes including phloem loading, seed filling, and nectar secretion, though its specific physiological roles may vary between rice subspecies. Current research suggests it may be involved in sugar transport mechanisms that affect plant development and stress responses.

How do the indica and japonica variants of SWEET7b differ?

There are notable differences between SWEET7b in the indica and japonica subspecies of rice. The indica variant (designated as A2YZ24 in UniProt) and the japonica variant (Q0J349) show some sequence variations that may affect protein function or regulation . While both function as bidirectional sugar transporters, these sequence differences might contribute to subspecies-specific adaptations.

Research approaches to study these differences include:

  • Comparative sequence analysis to identify non-synonymous mutations

  • Expression pattern analysis in different tissues

  • Functional characterization using heterologous expression systems

  • Transport kinetics assays to determine substrate preferences and efficiency

Researchers should consider these subspecies-specific differences when designing experiments and interpreting results, especially when extrapolating findings between indica and japonica rice variants.

What expression systems are optimal for producing recombinant SWEET7b?

Multiple expression systems have been successfully used for recombinant SWEET7b production, each with specific advantages for different research applications:

Expression SystemAdvantagesConsiderationsApplications
E. coliHigh yield, cost-effective, rapid expressionMay require refolding, limited post-translational modificationsStructural studies, antibody production
YeastBetter protein folding, some post-translational modificationsModerate yield, longer production timeFunctional assays, protein-protein interaction studies
Insect cellsNear-native folding, post-translational modificationsHigher cost, complex protocolsTransport studies, structural biology
Mammalian cellsMost authentic post-translational modificationsHighest cost, lowest yield, longest production timeDetailed functional studies

What are the recommended purification strategies for recombinant SWEET7b?

Purification of membrane proteins like SWEET7b requires specialized approaches to maintain protein integrity and functionality:

  • Affinity Chromatography: His-tagged SWEET7b can be purified using Ni-NTA columns under conditions that maintain protein folding . Typical protocols include:

    • Cell lysis with non-ionic detergents (0.5-1% DDM or LMNG)

    • Binding to Ni-NTA in the presence of 20-50 mM imidazole

    • Washing with 50-80 mM imidazole

    • Elution with 250-500 mM imidazole

    • Buffer containing 0.05-0.1% detergent throughout to prevent aggregation

  • Size Exclusion Chromatography: Secondary purification step to remove aggregates and impurities, typically using Superdex 200 columns with detergent-containing buffers.

  • Detergent Exchange: If needed for specific applications, initial detergent can be exchanged during purification.

Optimal buffer conditions typically include Tris-based buffers with 50% glycerol for storage, as indicated in product information for commercially available recombinant SWEET7b .

How can the proper folding and activity of purified SWEET7b be verified?

Verifying proper folding and activity of membrane transporters like SWEET7b is crucial before proceeding with functional studies:

  • Circular Dichroism (CD) Spectroscopy: To assess secondary structure content and proper folding of the purified protein.

  • Thermal Shift Assays: To evaluate protein stability under different buffer conditions.

  • Functional Reconstitution: Incorporation into liposomes or nanodiscs followed by transport assays using radiolabeled or fluorescent sugar substrates.

  • Binding Assays: Using isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) to verify substrate binding capabilities.

  • Tryptophan Fluorescence: To monitor conformational changes upon substrate binding.

When antibodies against SWEET7b are available, Western blotting can confirm protein integrity and expected molecular weight, with typical protocols using antigen-affinity purified antibodies at appropriate dilutions .

What are effective methods for studying SWEET7b transport activity?

Several complementary approaches can be used to characterize SWEET7b transport activity:

  • Heterologous Expression Systems:

    • Xenopus oocytes with two-electrode voltage clamp to measure transport-associated currents

    • Yeast mutants deficient in specific sugar transporters to assess complementation

    • Mammalian cell uptake assays with radiolabeled sugars

  • Reconstitution Systems:

    • Liposome-reconstituted protein with fluorescent sugar analogs

    • Proteoliposome counterflow assays

    • Solid-supported membrane electrophysiology

  • In Planta Methods:

    • FRET-based sugar sensors in transgenic plants

    • Radiotracer studies in plants with altered SWEET7b expression

    • Carbon-14 labeled sugar transport tracking

Each method provides different insights into transport kinetics, substrate specificity, and directional preferences, allowing researchers to build a comprehensive understanding of SWEET7b function.

How can SWEET7b antibodies be validated for specificity in research applications?

Proper validation of antibodies against SWEET7b is essential for reliable experimental results:

  • Positive Controls:

    • Testing against recombinant SWEET7b protein of known concentration

    • Using tissues/cells with confirmed SWEET7b overexpression

  • Negative Controls:

    • SWEET7b knockout/knockdown samples

    • Pre-immune serum testing

    • Peptide competition assays

  • Cross-Reactivity Assessment:

    • Testing against closely related SWEET family proteins

    • Testing in tissues known not to express SWEET7b

  • Application-Specific Validation:

    • For Western blotting: confirming single band at expected molecular weight

    • For immunoprecipitation: mass spectrometry verification of pulled-down proteins

    • For immunohistochemistry: comparison with mRNA expression patterns

Commercial SWEET7b antibodies, such as the rabbit polyclonal antibody mentioned in the search results, have been tested in applications like ELISA and Western blotting for identification of the antigen .

How does SWEET7b contribute to plant stress responses and sugar allocation?

SWEET transporters play crucial roles in plant stress responses through regulation of carbon partitioning:

  • Abiotic Stress Responses:

    • Under drought conditions, SWEET transporters can be differentially regulated to redirect carbohydrates to tissues requiring energy for stress adaptation

    • During cold stress, sugar transport patterns may shift to support cryoprotection

    • Salt stress may trigger changes in SWEET expression to support osmotic adjustment

  • Biotic Interactions:

    • Some SWEET transporters are targeted by pathogen effectors to manipulate host sugar efflux

    • Expression changes during symbiotic relationships to facilitate carbon exchange

  • Research Approaches:

    • Transcriptional profiling of SWEET7b under various stress conditions

    • Creation of SWEET7b overexpression/knockout lines to assess stress tolerance

    • Metabolite profiling in plants with altered SWEET7b expression

    • Sugar transport tracking using radioactive or fluorescent tracers

Understanding these roles requires integrated physiological, molecular, and biochemical approaches, particularly comparing responses in different rice subspecies that may have evolved distinct adaptive strategies.

What methodologies are most effective for studying SWEET7b localization and trafficking?

Determining the subcellular localization and trafficking of SWEET7b provides important insights into its function:

  • Fluorescent Fusion Proteins:

    • Generation of SWEET7b-GFP/YFP fusion constructs

    • Transient expression in protoplasts or stable transformation in rice

    • Confocal microscopy to track localization

    • Photoconvertible fluorescent tags to track protein movement

  • Immunolocalization Approaches:

    • Immunogold electron microscopy for high-resolution localization

    • Co-localization with organelle markers

    • Super-resolution microscopy techniques

  • Biochemical Fractionation:

    • Cell fractionation followed by Western blot analysis

    • Surface biotinylation to distinguish plasma membrane from internal pools

    • Protease protection assays to determine topology

  • Trafficking Studies:

    • Brefeldin A treatment to disrupt Golgi-mediated trafficking

    • Cycloheximide chase experiments to track protein turnover

    • Temperature blocks to arrest trafficking at specific steps

These complementary approaches can reveal not only the steady-state localization of SWEET7b but also its dynamic regulation in response to developmental or environmental signals.

How can protein aggregation issues with recombinant SWEET7b be overcome?

Membrane proteins like SWEET7b are prone to aggregation during expression and purification. Several strategies can mitigate this challenge:

  • Expression Optimization:

    • Lowering induction temperature (16-20°C)

    • Reducing inducer concentration

    • Using specialized E. coli strains (C41, C43, or Lemo21)

    • Co-expression with chaperones

  • Solubilization Optimization:

    • Screening multiple detergents (DDM, LMNG, DMNG, GDN)

    • Testing detergent mixtures

    • Incorporating lipids during solubilization

    • Adjusting detergent:protein ratios

  • Buffer Optimization:

    • Including glycerol (10-20%)

    • Adding stabilizing agents (arginine, specific lipids)

    • Optimizing pH and ionic strength

    • Including reducing agents if appropriate

  • Alternative Approaches:

    • Nanodiscs or SMALPs for detergent-free extraction

    • Fusion partners that enhance solubility (SUMO, MBP)

    • Cell-free expression systems

For storage, recombinant SWEET7b stability can be enhanced using Tris-based buffers with 50% glycerol as indicated in commercial product specifications . Preventing repeated freeze-thaw cycles is also crucial for maintaining protein integrity.

What controls are essential when studying SWEET7b transport kinetics?

Rigorous controls are essential when characterizing the transport properties of SWEET7b:

  • Negative Controls:

    • Non-functional SWEET7b mutants (e.g., pore-blocking mutations)

    • Empty vector/liposome controls

    • Transport assays in the presence of specific inhibitors

  • Substrate Specificity Controls:

    • Testing structurally related non-substrate molecules

    • Competition assays with known substrates

    • Concentration gradients to determine Km and Vmax

  • System-Specific Controls:

    • For oocyte expression: water-injected oocytes

    • For liposomes: protein-free liposomes

    • For cell-based assays: mock-transfected cells

  • Data Validation Approaches:

    • Technical and biological replicates

    • Multiple detection methods for the same parameter

    • Positive controls using well-characterized transporters

These controls help distinguish specific SWEET7b-mediated transport from background processes, ensuring reliable and reproducible characterization of transport kinetics.

How does SWEET7b compare functionally with other SWEET family members?

The SWEET family in rice includes multiple members with diverse functions and substrate preferences:

SWEET MemberPrimary LocalizationMain SubstratesPhysiological Roles
SWEET7bCell membraneGlucose, sucrose (predicted)Sugar distribution, potentially stress response
SWEET11/13PhloemSucrosePhloem loading, seed filling
SWEET1-4Various tissuesMonosaccharidesCell-to-cell sugar transport
SWEET14Various tissuesSucroseSusceptibility to bacterial blight

Research approaches to compare SWEET transporters include:

  • Phylogenetic analysis to understand evolutionary relationships

  • Expression pattern comparison across tissues and conditions

  • Transport assays with different substrates in comparable systems

  • Phenotypic analysis of respective knockout/knockdown lines

Understanding these relationships provides context for SWEET7b's specific roles and may reveal functional redundancy or specialization within the family.

What methods are most effective for distinguishing between different SWEET isoforms in experimental settings?

Distinguishing between similar SWEET isoforms presents a significant challenge in rice research:

  • Genetic Tools:

    • CRISPR-Cas9 mediated knockout of specific SWEET genes

    • Isoform-specific RNAi constructs

    • Promoter-reporter fusions to track expression patterns

  • Protein Detection:

    • Generation of isoform-specific antibodies

    • Epitope tagging of individual SWEETs

    • Mass spectrometry-based proteomics with unique peptide identification

  • Functional Discrimination:

    • Transport kinetics comparison

    • Substrate preference profiling

    • Inhibitor sensitivity assays

  • Computational Approaches:

    • In silico modeling of binding pockets

    • Molecular dynamics simulations

    • Sequence-based functional prediction

These approaches, used in combination, allow researchers to attribute observed phenotypes and functions to specific SWEET isoforms despite their sequence similarity.

What emerging technologies show promise for advancing SWEET7b research?

Several cutting-edge technologies offer new opportunities for SWEET7b characterization:

  • Structural Biology Advances:

    • Cryo-EM for membrane protein structures without crystallization

    • Serial femtosecond crystallography at X-ray free electron lasers

    • Integrative structural biology combining multiple data types

  • Advanced Functional Assays:

    • Single-molecule transport measurements

    • Real-time in vivo sugar imaging with genetically encoded sensors

    • Microfluidic-based transport assays

  • Genome Editing Developments:

    • Base editing for precise point mutations

    • Prime editing for targeted sequence replacements

    • CRISPR interference/activation for temporal control

  • Computational Tools:

    • AlphaFold2 and similar AI tools for structure prediction

    • Molecular dynamics simulations of transport mechanisms

    • Systems biology models integrating transport with metabolism

Researchers should consider how these emerging technologies might be applied to resolve outstanding questions about SWEET7b structure, regulation, and physiological roles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.