Recombinant Oryza sativa subsp. japonica Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase (CCAMK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
CCAMK; DMI3; Os05g0489900; LOC_Os05g41090; OJ1119_H02.20; OsJ_19014; Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase; OsCCaMK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-516
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
CCAMK
Target Protein Sequence
MSKTESRKLSDDYEVVDVLGRGGFSIVRRGVSKSEEKTQVAIKTLRRLGPAMAGMKQGTK PVPGSGLPMWKQVSISDALLTNEILVMRRIVESVAPHPNVINLHDVYEDVHGVHLVLELC SGGELFDRIVGRDRYSEFDAACVIRQIASGLEALHKASIVHRDLKPENCLFSDKDEKSTL KIMDFGLSSVEDFSDPIVALFGSIDYVSPEALSRQEVSAASDMWSVGVILYILLSGCPPF HAATNREKQQRILQGEFSFQDHTWKTISSSAKDLISRLLSVQPYKRPTASDLLRHPWVIG DCAKQDLMDAEVVSKLQKFNARRKLRAAAIASVLSCKVALRTKRLRNLLGTHDLTSEELD NLRLHFGRICADGENATLSEFEQVLRAMKMDSLIPLAPRVFDLFDNNRDGTVDMREILCG FSSLRNSRGDDALRLCFQMYDADRSGCISKEELASMLRALPEECLPGDITEPGKLDEVFD QMDADSDGKVTFDEFKAAMNKDSALQDVLLSSLRPQ
Uniprot No.

Target Background

Function

This calcium- and calmodulin-dependent protein kinase is essential for arbuscular mycorrhizal (AM) symbiosis. It plays a role in responding to water deprivation stress and is crucial for abscisic acid (ABA)-induced antioxidant defense and oxidative stress tolerance during dehydration. This kinase functions upstream of MPK1 within an ABA signaling pathway regulating antioxidant enzyme activity and hydrogen peroxide production.

Database Links

STRING: 39947.LOC_Os05g41090.1

UniGene: Os.51939

Protein Families
Protein kinase superfamily, CAMK Ser/Thr protein kinase family, CaMK subfamily
Subcellular Location
Nucleus. Cytoplasm. Cell membrane; Peripheral membrane protein.
Tissue Specificity
Mainly expressed in roots and panicles. Detected in leaves, shoots and culms.

Q&A

What is the basic structure of OsCCaMK and how does it differ from related kinases?

OsCCaMK is a calcium and calcium/calmodulin-dependent protein kinase that contains three key domains: a serine/threonine kinase domain, a calmodulin binding domain (CaMB), and calcium-binding EF-hand domains. CCaMK differs from animal CaM kinases by its dual ability to bind free calcium via EF-hand domains and to bind calcium through calmodulin .

OsCCaMK is closely related to calcium-dependent protein kinases (CDPKs), with the main differences being:

  • CCaMKs contain three EF-hand motifs while CDPKs have four

  • CCaMKs possess overlapping autoinhibitory and CaMB domains

  • CCaMKs have a distinctive distribution pattern in plants (absent in cruciferous species)

What are the key regulatory mechanisms of OsCCaMK activation?

OsCCaMK activation involves a complex regulatory mechanism based on calcium binding and autophosphorylation:

  • Calcium sensing: The EF-hand domains bind calcium directly, causing conformational changes in the protein.

  • Calmodulin binding: The CaMB domain interacts with calmodulin in a calcium-dependent manner.

  • Autophosphorylation: Key residues including threonine residues (equivalent to T271 in Medicago truncatula) are autophosphorylated.

  • Conformational changes: Upon calcium binding, CCaMK undergoes conformational changes that likely correspond to an elongation of the visinin-like domain, exposing a hydrophobic patch that facilitates binding to target proteins .

Interestingly, research indicates that CCaMK forms an oligomer of 16-18 subunits when purified from E. coli, and evidence suggests an intra-oligomeric, inter-subunit mechanism of autophosphorylation .

What are the optimal expression and purification methods for recombinant OsCCaMK?

For optimal expression and purification of recombinant OsCCaMK:

Expression System:

  • Yeast expression systems have shown good results for producing functional recombinant OsCCaMK

  • E. coli systems can also be used, particularly when fused with MBP (maltose-binding protein) to improve solubility

Purification Protocol:

  • Express the protein with appropriate tags (His-tag or MBP-tag)

  • Harvest cells and lyse using appropriate buffer (typically containing protease inhibitors)

  • Purify using affinity chromatography

  • Further purify by size exclusion chromatography if needed

  • For storage, add 5-50% glycerol and store at -20°C/-80°C

Key Considerations:

  • Recommended reconstitution in deionized sterile water to 0.1-1.0 mg/mL

  • Avoid repeated freezing and thawing; store working aliquots at 4°C for up to one week

  • For long-term storage, glycerol concentration should be 50%

How can I accurately measure CCaMK kinase activity in vitro?

For accurate measurement of CCaMK kinase activity:

In vitro Kinase Assay Protocol:

  • Prepare purified CCaMK protein in appropriate buffer

  • Set up reaction mixtures containing:

    • Purified CCaMK (0.5-1 μg)

    • Substrate protein (e.g., OsMKK1 for rice CCaMK)

    • ATP (typically 100-200 μM)

    • Kinase buffer containing Mg²⁺

    • ±Ca²⁺ and calmodulin for differential activity tests

  • Incubate at 25-30°C for 30 minutes

  • Analyze phosphorylation by:

    • SDS-PAGE followed by autoradiography (if using [γ-³²P]ATP)

    • Western blotting with phospho-specific antibodies

    • Mass spectrometry to identify specific phosphorylation sites

Measuring CaM Binding:
To determine the binding affinity of CCaMK for calmodulin, fluorescence anisotropy spectroscopy can be used with dansyl-labeled CaM (D-CaM):

  • Label CaM with dansyl chloride

  • Titrate CCaMK into a solution containing 2 nM D-CaM

  • Use buffer containing either 0.2 mM CaCl₂ or 0.1 mM EDTA

  • Record fluorescence anisotropy using excitation and emission wavelengths of 335 and >390 nm

How does OsCCaMK function in rice symbiosis with different microorganisms?

OsCCaMK functions as a central regulatory component in multiple symbiotic relationships:

Arbuscular Mycorrhizal Symbiosis:

  • OsCCaMK is required for fungal accommodation in rice roots

  • Expression of OsCCaMK is detected throughout rice growth stages, even under anaerobic paddy conditions

  • The genotype of OsCCaMK influences the composition of root-associated bacterial communities

Bacterial Symbiosis:

  • OsCCaMK appears to control both methane oxidation and nitrogen fixation in the rice root zone under low-nitrogen field conditions

  • In field experiments with OsCCaMK mutants (NE1115), significant differences were observed in:

    • Plant growth (decreased compared to wild-type, especially in low-nitrogen fields)

    • Methane flux (significantly higher in mutants in low-nitrogen fields)

    • Bacterial community composition (lower abundance of methanotrophs in mutants)

Table: Impact of OsCCaMK mutation on methane flux in paddy fields

YearConditionCH₄ flux increase in NE1115 vs. WT
2011Low-nitrogen156-407%
2012Low-nitrogen170-816%
Both yearsStandard-nitrogenNo significant difference

Can OsCCaMK restore symbiotic function in legume mutants, and what does this reveal about evolutionary conservation?

Yes, OsCCaMK from rice can restore nodule formation in legume mutants, revealing important insights about evolutionary conservation:

Cross-species Functionality:

  • Studies show that a CCaMK gene from rice can restore nodule formation in a Medicago truncatula dmi3 mutant

  • This indicates that CCaMKs from non-legumes can interpret the calcium signature elicited by rhizobial Nod factors and activate appropriate downstream targets

Evolutionary Implications:

  • This functionality suggests that the basic mechanism of calcium signal interpretation by CCaMK predates the evolution of legume-specific symbiosis

  • The nodules formed in complemented mutants did not contain bacteria, suggesting DMI3 is also involved in the control of the infection process

  • These findings challenge the hypothesis that legumes evolved a particular form of CCaMK specifically to discriminate between rhizobial and mycorrhizal calcium signatures

Conservation Analysis:

  • CCaMK is found only in land plants and is completely lost in all cruciferous species

  • This distribution correlates with the ability to establish rhizobial and arbuscular mycorrhizal symbioses

  • The ability of rice CCaMK to complement legume mutants suggests that the fundamental activation mechanism is conserved across diverse plant species

How does OsCCaMK directly interact with downstream targets in signaling cascades?

OsCCaMK interacts with several downstream targets through phosphorylation:

MAPK Cascade Activation:

  • OsDMI3 (rice CCaMK) directly phosphorylates OsMKK1 (a MAPK kinase)

  • Phosphorylation sites have been identified on OsMKK1 (Thr25, Ser72, Ser66, and Thr89)

  • This phosphorylation activates the MAPK cascade, which plays an important role in abscisic acid (ABA) signaling

Specificity Mechanisms:

  • The visinin-like domain of CCaMK undergoes calcium-induced conformational changes

  • These changes expose a hydrophobic patch that facilitates binding to target proteins

  • Specific amino acid residues in the CaM binding domain (e.g., E319, L324, L333, and S343 in Medicago truncatula) play crucial roles in determining both CaM binding and target interaction specificity

Regulatory Feedback:

  • Thr-271 phosphorylation (in Medicago truncatula) represses CCaMK activity

  • CaM binding protects Thr-271 from phosphorylation, creating a regulatory feedback loop

What are the implications of OsCCaMK research for greenhouse gas mitigation in rice cultivation?

OsCCaMK research reveals significant implications for greenhouse gas mitigation in rice cultivation:

Methane Regulation in Paddy Fields:

  • OsCCaMK mutants (NE1115) showed significantly higher methane flux (156-816% increase) compared to wild-type rice in low-nitrogen fields

  • Wild-type rice with functional OsCCaMK had significantly higher methanotroph populations in roots and rhizosphere soil, as evidenced by higher copy numbers of the pmoA gene (encoding methane monooxygenase)

Mechanism and Applications:

  • OsCCaMK appears to control microbial methane oxidation in the rice root zone

  • This regulation may occur through effects on root-associated bacterial community composition

  • Principal coordinate analysis revealed unidirectional shifts in bacterial community structure responding to OsCCaMK genotype

Potential Applications:

  • Development of rice varieties with optimized OsCCaMK function could reduce methane emissions from rice paddies

  • Targeted management of OsCCaMK-dependent microbial communities could be a strategy for greenhouse gas mitigation

  • Combined optimization of nitrogen fixation and methane oxidation in the rice rhizosphere through OsCCaMK-based approaches

What methodological approaches are most effective for studying OsCCaMK phosphorylation patterns and their functional significance?

Advanced Phosphorylation Analysis Techniques:

  • Mass Spectrometry-Based Approaches:

    • Phosphopeptide enrichment using titanium dioxide (TiO₂) or immobilized metal affinity chromatography (IMAC)

    • LC-MS/MS analysis to identify specific phosphorylation sites

    • Quantitative phosphoproteomics using stable isotope labeling (SILAC) or label-free methods to compare phosphorylation states under different conditions

  • Structural Analysis:

    • Homology modeling based on similar proteins like CDPKs

    • Energy minimization to predict conformational changes upon phosphorylation

    • DeepView software can be used to build homology models based on structural scaffolds like 3hx4 (activated form) and 3ku2 (inactive form)

  • Functional Validation:

    • Site-directed mutagenesis to create phospho-mimetic (S/T→D/E) and phospho-ablative (S/T→A) mutations

    • Expression of mutant variants in ccamk knockout plants to assess functional complementation

    • Analysis of gene expression patterns using RNA-seq or RT-qPCR to identify downstream targets

Case Study Approach:
The study of phosphorylation of Thr-271 in Medicago truncatula CCaMK provides a methodological template:

  • Researchers used a combination of in vitro kinase assays, site-directed mutagenesis, and in planta complementation

  • They identified that T271 phosphorylation creates a deactivated state of CCaMK

  • CaM binding protects T271 from phosphorylation, creating a regulatory switch mechanism

This multi-faceted approach combining biochemical, structural, and genetic methods provides the most comprehensive understanding of phosphorylation patterns and their functional significance.

What are common challenges in OsCCaMK expression and activity assays, and how can they be addressed?

Expression Challenges and Solutions:

ChallengeSolution
Poor protein solubilityUse fusion tags (MBP, GST, SUMO) to enhance solubility
Protein degradationInclude protease inhibitors; express at lower temperatures (16-18°C)
Low yieldOptimize codon usage for expression system; try different promoters
Loss of activity during purificationInclude calcium chelators in buffers; maintain protein in glycerol
AggregationAdd detergents or stabilizing agents; use size exclusion chromatography

Activity Assay Optimization:

  • Ensure proper calcium concentrations (typically 0.1-0.5 mM) for optimal activation

  • Include controls for calcium-dependent and calcium-independent activity

  • Test multiple substrate concentrations to determine reaction kinetics

  • Maintain consistent temperature (typically 25-30°C) during kinase reactions

  • Consider the oligomeric state of CCaMK (16-18 subunits) when designing assays

How can researchers distinguish between the roles of OsCCaMK in different symbiotic pathways?

To distinguish between OsCCaMK's roles in different symbiotic pathways:

Experimental Approaches:

  • Domain-specific mutations:

    • Mutations in specific domains can differentially affect symbiotic outcomes

    • For example, in Medicago truncatula, rhizobial infection processes were strictly dependent on the CaM-binding domain, which was dispensable for arbuscular mycorrhizal symbiosis

  • Transcriptional analysis:

    • RNA-seq of wild-type vs. ccamk mutants under different symbiotic conditions

    • Comparison of transcriptional responses to rhizobial vs. mycorrhizal colonization

  • Protein interaction studies:

    • Identify pathway-specific interaction partners using techniques like:

      • Yeast two-hybrid screening

      • Co-immunoprecipitation followed by mass spectrometry

      • Bimolecular fluorescence complementation (BiFC)

  • Phosphoproteomics:

    • Compare phosphorylation patterns induced by different symbiotic signals

    • Identify pathway-specific phosphorylation targets

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.