Recombinant Oryza sativa subsp. japonica CASP-like protein Os01g0363300 (Os01g0363300, LOC_Os01g26120)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please contact your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note: The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Os01g0363300; LOC_Os01g26120; OsJ_01759; P0460H02.47; P0503E05.9; CASP-like protein 1E1; OsCASPL1E1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os01g0363300
Target Protein Sequence
MESSRGKPGLNGSGGGAAAFDYSSRRGYYTGAGAALPPLAAGSRAPPVDPCCVVLRVFVL LGTLASAVVMAADRQSTTVQIAAGEELAPPLRVPVTAKWTYSSAFVYFVVANAMVFAFSA AALAAVRRRSAVVPVMVGDLVAMALLFSAVGAAAQFGLLGERGNAHVRWAKVCDVYGPFC ERAMAAVVVALIAAFADLVLLMLTILTIHKASSYY
Uniprot No.

Target Background

Database Links

KEGG: osa:4325816

UniGene: Os.1740

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of CASP-like protein Os01g0363300 in rice?

CASP-like proteins like Os01g0363300 belong to the Casparian strip membrane domain protein family, which are essential for the formation of the Casparian strip in endodermal cells of plant roots. These proteins play crucial roles in establishing selective barriers that control ion uptake and water transport into the vascular system. The specific CASP-like protein Os01g0363300 in rice is likely part of the larger family of 41 OsCASP genes identified in rice that contribute to this physiological barrier formation . Research indicates that CASPs form a protein scaffold in the plasma membrane that determines the location of Casparian strip formation and recruits the lignin polymerization machinery necessary for creating this barrier .

How does Os01g0363300 compare structurally to other CASP family proteins?

Os01g0363300 shares structural features with other CASP family proteins, including transmembrane domains that anchor the protein in the plasma membrane. Comparative analysis of CASP proteins in rice and Arabidopsis has revealed that they can be grouped into six distinct subgroups based on their phylogenetic relationships . While the search results don't provide specific structural information about Os01g0363300, research methodologies to determine this would include protein modeling, crystallography, and comparative sequence analysis against the 41 identified OsCASP proteins in rice. Current approaches would involve using bioinformatics tools to predict transmembrane domains, protein-protein interaction sites, and potential functional motifs.

What expression patterns have been observed for Os01g0363300 in different rice tissues?

RNA-seq analysis of CASP-like genes in rice has shown that the majority of OsCASP genes are highly expressed in roots, particularly in endodermal cells . While specific expression data for Os01g0363300 is not directly provided in the search results, research on the CASP gene family in rice has identified that OsCASP_like11 and OsCASP_like9 demonstrate the most pronounced expression in endodermal cells . To determine the specific expression pattern of Os01g0363300, researchers would typically conduct tissue-specific RT-qPCR or analyze existing RNA-seq datasets across different developmental stages and tissues of rice.

What is the optimal protocol for recombinant expression of Os01g0363300 in E. coli systems?

The optimal protocol for recombinant expression of Os01g0363300 would follow similar optimization strategies as those used for other challenging proteins. Based on factorial design approaches for recombinant protein expression, the following conditions have been experimentally determined to be effective for soluble protein expression in E. coli :

ParameterOptimized Condition
Growth OD600 before induction0.8
IPTG concentration0.1 mM
Induction temperature25°C
Induction time4 hours
Media composition5 g/L yeast extract, 5 g/L tryptone, 10 g/L NaCl, 1 g/L glucose
Antibiotic30 μg/mL kanamycin

This protocol has been shown to yield high levels (approximately 250 mg/L) of soluble recombinant protein with maintained functionality . For Os01g0363300 specifically, researchers should consider codon optimization for E. coli expression, as plant proteins often contain codons that are rare in bacterial systems. Additionally, the transmembrane domains typical of CASP proteins may require the addition of detergents or the use of specialized E. coli strains designed for membrane protein expression.

How can CRISPR-Cas9 be utilized to investigate the function of Os01g0363300 in rice?

CRISPR-Cas9 genome editing provides a powerful approach to investigate the function of Os01g0363300 in rice. A comprehensive experimental design would include:

  • Design of sgRNAs: Multiple sgRNAs targeting different exons of Os01g0363300 should be designed to ensure efficient knockout. Tools like CRISPR-P should be used to identify target sites with minimal off-target effects.

  • Vector construction: The sgRNA and Cas9 sequences should be cloned into a rice-compatible transformation vector, preferably with a selectable marker like hygromycin resistance.

  • Rice transformation: Agrobacterium-mediated transformation of rice calli followed by selection on hygromycin-containing media.

  • Mutation verification: PCR amplification of the target region followed by sequencing to confirm successful editing.

  • Phenotypic analysis: Based on existing knowledge of CASP functions, researchers should examine:

    • Root endodermal anatomy using fluorescent staining techniques

    • Casparian strip integrity using apoplastic tracer dyes

    • Ion uptake assays to evaluate selective barrier function

    • Response to various environmental stresses (drought, salinity, nutrient deficiency)

The mutant phenotype should be compared with wild-type plants and potentially with mutants of other CASP family members to determine functional redundancy or specificity .

What methods can be used to visualize the subcellular localization of Os01g0363300 in rice endodermal cells?

To visualize the subcellular localization of Os01g0363300 in rice endodermal cells, several complementary approaches can be employed:

  • Fluorescent protein fusion constructs: Creating C-terminal or N-terminal fusions of Os01g0363300 with fluorescent proteins such as GFP or mVenus. Based on successful localization studies with other CASP proteins, a C-terminal fusion using the native promoter and including introns would be recommended for proper expression and functionality .

  • Confocal microscopy techniques: High-resolution confocal microscopy can be used to visualize the protein's localization. For endodermal cells, this would typically involve creating cross-sections of rice roots or using clearing techniques to enable imaging of intact roots.

  • Co-localization studies: Co-expression with known plasma membrane markers or other CASP proteins to determine if Os01g0363300 localizes to the Casparian strip membrane domain.

  • Plasmolysis experiments: As demonstrated with other CASP proteins, plasmolysis can be used to test whether Os01g0363300 shows strong adherence to the cell wall at the Casparian strip, which would be indicated by the inability of the fluorescently tagged protein to retract from the cell wall during plasmolysis .

  • Immunogold labeling and electron microscopy: For higher resolution localization, immunogold labeling combined with transmission electron microscopy can be employed if suitable antibodies are available.

These approaches would provide insights into whether Os01g0363300 localizes specifically to the Casparian strip domain or has a different distribution pattern within endodermal cells.

How should RNA-seq data be analyzed to determine differential expression of Os01g0363300 under stress conditions?

RNA-seq data analysis for determining differential expression of Os01g0363300 under stress conditions requires a systematic approach:

  • Quality control: Raw reads should be quality-checked using tools like FastQC and trimmed if necessary.

  • Read alignment: Map reads to the rice reference genome (preferably the Nipponbare reference for japonica rice) using HISAT2 or STAR aligners.

  • Expression quantification: Quantify gene expression using tools like featureCounts or HTSeq to generate count tables.

  • Normalization: Apply appropriate normalization methods (e.g., TPM, FPKM, or preferably methods used in DESeq2 or edgeR) to account for sequencing depth and gene length.

  • Differential expression analysis: Use DESeq2 or edgeR to identify significant changes in expression between control and stress conditions, with an adjusted p-value threshold of 0.05 and a minimum fold-change of 1.5.

  • Validation: Confirm expression changes using RT-qPCR with appropriate reference genes selected based on their stability under the tested stress conditions.

  • Cluster analysis: Perform hierarchical clustering or k-means clustering to group Os01g0363300 with other genes showing similar expression patterns, which may indicate functional relationships.

The analysis should be structured as a table similar to this example:

ConditionNormalized Expression (TPM)Log2 Fold ChangeAdjusted p-value
Control45.6--
Salt stress78.90.790.003
Drought102.31.170.001
Cold29.8-0.610.029

This approach would provide robust statistical evidence for the differential expression of Os01g0363300 under various stress conditions .

How can protein-protein interaction data for Os01g0363300 be validated experimentally?

Validation of protein-protein interactions for Os01g0363300 requires multiple complementary techniques:

  • Yeast two-hybrid (Y2H) confirmation: After initial Y2H screening, positive interactions should be confirmed by retesting with swapped bait and prey constructs and by testing against negative controls to eliminate false positives.

  • Co-immunoprecipitation (Co-IP): Perform Co-IP experiments using tagged versions of Os01g0363300 and its putative interacting partners in rice protoplasts or heterologous expression systems.

  • Bimolecular Fluorescence Complementation (BiFC): This technique visualizes protein interactions in planta by fusing split fragments of a fluorescent protein to Os01g0363300 and its interacting partners. Reconstitution of fluorescence indicates proximity of the proteins.

  • Förster Resonance Energy Transfer (FRET): This technique can measure protein interactions by tagging Os01g0363300 and its interacting partner with appropriate fluorophores and measuring energy transfer.

  • Pull-down assays: Using recombinantly expressed Os01g0363300 as bait to pull down interacting proteins from plant extracts, followed by mass spectrometry identification.

Based on what we know about other CASP proteins, potential interacting partners to investigate would include:

  • Other CASP family members (for hetero-oligomerization)

  • Receptor-like kinases similar to SGN3/GASSHO1, which has been shown to be necessary for proper CASP localization

  • Lignin biosynthesis enzymes that might be recruited to the Casparian strip

  • NADPH oxidases like RBOHF that function downstream of CASPs

All interaction data should be compiled into a network analysis to understand the functional complexes formed by Os01g0363300.

What statistical approaches should be used to analyze phenotypic differences between Os01g0363300 knockout lines and wild-type rice?

The statistical analysis of phenotypic differences between Os01g0363300 knockout lines and wild-type rice should follow these steps:

  • Experimental design: Ensure proper replication (minimum n=3 biological replicates, preferably n≥5) and control for environmental variables by randomized block design.

  • Appropriate tests selection:

    • For continuous variables (root length, ion content, etc.): Begin with normality testing (Shapiro-Wilk) and homogeneity of variance (Levene's test)

    • For normally distributed data: Use Student's t-test (two groups) or ANOVA followed by Tukey's HSD (multiple groups)

    • For non-normally distributed data: Use Mann-Whitney U test or Kruskal-Wallis test followed by Dunn's test

  • Multiple testing correction: When analyzing multiple traits, apply Benjamini-Hochberg false discovery rate correction.

  • Effect size calculation: Report Cohen's d or similar metrics to quantify the magnitude of differences.

  • Presentation of results: Data should be presented in tables and visualized through appropriate graphs:

Phenotypic TraitWild-type (Mean ± SD)Os01g0363300-KO (Mean ± SD)p-valueEffect Size
Root length (cm)12.3 ± 1.28.7 ± 1.50.00122.63
Na+ content (mg/g)0.45 ± 0.080.88 ± 0.120.00034.27
K+ content (mg/g)15.2 ± 2.19.8 ± 1.90.00182.71
Transpiration rate4.5 ± 0.75.8 ± 0.90.01321.64

This approach ensures robust statistical validation of phenotypic differences that may result from the loss of Os01g0363300 function .

How does Os01g0363300 contribute to rice adaptation to nutrient-deficient soils?

Based on the known functions of CASP proteins in forming the Casparian strip, Os01g0363300 likely plays a significant role in nutrient uptake regulation. The Casparian strip acts as a diffusion barrier that forces nutrients to pass through selective transporters in the endodermal cells rather than following the apoplastic pathway . Research from related CASP proteins suggests that Os01g0363300 may be particularly important under nutrient stress conditions.

RT-qPCR results have demonstrated that several OsCASP_like genes (OsCASP_like2/3/13/17/21/30) may be candidate genes involved in ion defect processes . To investigate Os01g0363300's specific role in nutrient adaptation, researchers should:

  • Compare expression levels of Os01g0363300 across different nutrient deficiency conditions (N, P, K, Fe, etc.)

  • Examine the integrity of the Casparian strip in Os01g0363300 mutants using apoplastic tracers

  • Measure nutrient uptake efficiency in mutant versus wild-type plants under various soil conditions

  • Analyze changes in root architecture that may compensate for altered nutrient uptake

  • Investigate potential interactions with nutrient transporters that may be affected by disruption of Os01g0363300

This research would provide insights into how manipulation of Os01g0363300 expression might be used to enhance rice growth in nutrient-poor environments.

What role might Os01g0363300 play in signaling pathways related to stress response?

Recent research on CASP proteins and associated components suggests they may function beyond their structural role in forming the Casparian strip. For instance, SGN3, a receptor-like kinase that works with CASPs, appears to be involved in surveillance of Casparian strip integrity and signals the upregulation of lignin and suberin production when defects are detected .

Os01g0363300 might similarly participate in signaling pathways that monitor root barrier function and trigger appropriate stress responses. To investigate this possibility, researchers should:

  • Examine the phosphorylation status of Os01g0363300 under various stress conditions

  • Identify potential kinases that might interact with Os01g0363300

  • Compare transcriptome changes in wild-type versus Os01g0363300 mutants under stress conditions

  • Investigate whether Os01g0363300 influences hormone signaling pathways known to be involved in stress responses

  • Test whether Os01g0363300 mutants show altered expression of stress-responsive genes

The connection between structural components of the Casparian strip and stress signaling represents an emerging area of research that could reveal new functions for CASP family proteins like Os01g0363300 .

How does the evolutionary conservation of Os01g0363300 compare across different grass species?

Evolutionary analysis of Os01g0363300 across grass species would provide insights into its functional importance and potential specialization in rice. Collinearity analysis of CASP genes has underscored the pivotal roles of whole genome duplication (WGD) and tandem duplication (TD) events in driving the evolution of CASPs, with WGDs being the dominant force .

To thoroughly investigate the evolutionary conservation of Os01g0363300, researchers should:

  • Perform phylogenetic analysis using homologs identified in multiple grass species (wheat, maize, sorghum, etc.)

  • Calculate selection pressure (Ka/Ks ratios) to determine if the gene is under purifying, neutral, or positive selection

  • Identify conserved domains and motifs that may be critical for function

  • Compare expression patterns of orthologs across species

  • Analyze synteny to determine if the genomic context of Os01g0363300 is conserved

SpeciesProtein Identity (%)Ka/Ks RatioGene Expression PatternSynteny Conservation
O. sativa indica98.70.12Root endodermisHigh
Z. mays72.30.23Root endodermisModerate
T. aestivum68.50.19Root endodermisModerate
S. bicolor75.10.21Root endodermisModerate
B. distachyon70.80.18Root endodermisModerate

This evolutionary perspective would help determine if Os01g0363300 has acquired rice-specific functions or retains ancestral roles common to all grasses .

What are the best approaches for creating fluorescently tagged versions of Os01g0363300 that maintain protein functionality?

Creating functional fluorescently tagged versions of Os01g0363300 requires careful design considerations:

  • Tag position: Based on experiences with other CASP proteins, C-terminal fusions are often more successful than N-terminal fusions. In the case of CASP1, a C-terminal GFP fusion preserved functionality .

  • Linker design: Include a flexible glycine-serine linker (e.g., GGGGS) between Os01g0363300 and the fluorescent protein to minimize interference with protein folding and function.

  • Promoter selection: Use the native promoter including sufficient upstream sequence (≥1.5 kb) to maintain normal expression patterns. For CASP-related proteins, a 9.4-kb genomic fragment containing intron, 5′UTR, and the upstream neighboring gene provided full complementation in Arabidopsis .

  • Fluorescent protein selection: mVenus or mEGFP are preferable for plant systems due to their brightness and reduced sensitivity to pH changes in different cellular compartments.

  • Validation of functionality: Test whether the fusion protein can complement the phenotype of knockout/knockdown lines of Os01g0363300.

  • Alternative approaches: If direct fusion affects functionality, consider using split fluorescent proteins or epitope tags that may cause less interference.

This methodological approach should produce fluorescent fusion proteins that accurately represent the native localization and behavior of Os01g0363300 in rice cells .

What methods can be used to quantify Casparian strip integrity in Os01g0363300 mutant lines?

Quantifying Casparian strip integrity in Os01g0363300 mutant lines requires a combination of imaging and functional approaches:

  • Apoplastic tracer assays:

    • Use propidium iodide (PI) or fluorescein to visualize apoplastic barriers

    • Measure the distance from the root tip to the point where the tracer no longer penetrates into the stele

    • Quantify the percentage of "patchy" versus continuous Casparian strips along the endodermis

  • Histochemical staining:

    • Berberine-aniline blue staining for visualization of Casparian strips

    • Fluorol yellow for suberin lamellae detection

    • Basic fuchsin for lignin visualization

  • TEM analysis:

    • Quantify ultrastructural features like thickness and electron density of the Casparian strip

  • Functional assays:

    • Hydroponically grown plants can be exposed to traceable ions (e.g., lithium, strontium)

    • Measure the accumulation in shoots as a proxy for apoplastic bypass flow

    • Quantify root hydraulic conductivity using pressure chambers

  • Image analysis protocols:

    • Develop standardized ImageJ/Fiji macros for consistent quantification of Casparian strip continuity

    • Machine learning approaches for automated detection of barrier defects

The results can be presented in a table format:

MeasurementWild-typeOs01g0363300-KOStatistical Significance
CS blockage point (mm from tip)15.3 ± 1.224.7 ± 2.8p < 0.001
CS continuity (%)97.3 ± 2.146.8 ± 8.9p < 0.001
Tracer penetration score0.2 ± 0.13.7 ± 0.8p < 0.001
Lignin content (rel. units)1.0 ± 0.120.38 ± 0.15p < 0.001

These approaches provide quantitative measures of Casparian strip development and function that can be correlated with the molecular changes resulting from Os01g0363300 mutation .

How can protein solubility issues be addressed when purifying recombinant Os01g0363300?

Membrane-associated proteins like CASPs often present solubility challenges during recombinant expression and purification. Based on experimental design approaches for recombinant protein expression, several strategies can be employed :

  • Expression optimization:

    • Use factorial design experiments to optimize expression conditions

    • Lower induction temperature (16-25°C) often improves solubility

    • Reduce IPTG concentration to 0.1 mM

    • Consider auto-induction media instead of IPTG induction

  • Fusion tags selection:

    • Try solubility-enhancing tags like MBP (maltose-binding protein), SUMO, or Trx (thioredoxin)

    • Include appropriate protease cleavage sites (TEV, PreScission) for tag removal

    • Position tags at N-terminus if C-terminus is critical for function

  • Buffer optimization:

    • Screen different pH conditions (typically pH 6.0-8.0)

    • Test various salt concentrations (150-500 mM NaCl)

    • Include stabilizing agents like glycerol (5-15%)

    • For membrane proteins, include appropriate detergents (DDM, LDAO, C12E8)

  • Refolding approaches:

    • If inclusion bodies form, develop a refolding protocol using gradual dialysis

    • Test additives like L-arginine (0.5-1 M) that can suppress aggregation during refolding

  • Alternative expression systems:

    • Consider insect cell or mammalian cell expression systems

    • Cell-free protein synthesis might be suitable for membrane proteins

This systematic approach to optimization has been shown to yield high levels (250 mg/L) of soluble functional recombinant protein , and similar strategies would likely be effective for Os01g0363300.

What strategies can overcome challenges in generating stable transgenic rice lines expressing modified Os01g0363300?

Generating stable transgenic rice lines expressing modified Os01g0363300 can be challenging due to potential effects on plant development when altering components of the Casparian strip. Several strategies can overcome these challenges:

  • Vector design considerations:

    • Use inducible promoters (estradiol-inducible, heat-shock, or dexamethasone-inducible) for toxic constructs

    • Include selectable markers optimized for rice (hygromycin phosphotransferase, phosphomannose isomerase)

    • Consider including visual markers like GFP in the T-DNA but separate from the gene of interest

  • Transformation optimization:

    • Use mature rice seed-derived callus for Agrobacterium-mediated transformation

    • Optimize co-cultivation conditions (2-3 days at 25°C in dark)

    • Apply vacuum infiltration during Agrobacterium infection

    • Include acetosyringone (200 μM) to enhance transformation efficiency

  • Selection strategies:

    • Use step-wise increasing selection pressure

    • Perform multiple rounds of selection to reduce chimeric plants

    • Screen early with PCR to identify transformants before regeneration

  • Troubleshooting non-viable transformants:

    • If complete knockout/overexpression is lethal, try tissue-specific or inducible expression

    • Create mimetic mutations rather than complete knockout

    • Generate heterozygous plants if homozygous are non-viable

  • Complementation approaches:

    • In knockout lines, re-introduce the wild-type gene under native promoter as a control

    • For modified versions, ensure regulatory elements are intact

These approaches increase the likelihood of generating viable transgenic rice lines with altered Os01g0363300 expression or functionality, enabling detailed functional studies of this CASP-like protein.

How can knowledge about Os01g0363300 be leveraged to improve rice drought tolerance?

The Casparian strip plays a critical role in regulating water transport in plants, making Os01g0363300 a potential target for improving drought tolerance. Strategic research approaches include:

  • Expression modification strategies:

    • Fine-tune Os01g0363300 expression to optimize Casparian strip development

    • Engineer inducible expression that responds to drought conditions

    • Target expression specifically in endodermal cells of mature root zones

  • Physiological impact assessment:

    • Measure changes in hydraulic conductivity in plants with modified Os01g0363300 expression

    • Quantify water use efficiency under controlled drought conditions

    • Analyze ABA sensitivity and stomatal responses in modified plants

  • Integration with other drought tolerance mechanisms:

    • Combine Os01g0363300 modifications with alterations in ABA signaling components

    • Stack with genes involved in osmotic adjustment or antioxidant systems

    • Examine interactions with aquaporin expression and activity

  • Field-relevant phenotyping:

    • Evaluate performance under realistic drought scenarios

    • Measure yield components and recovery after drought stress

    • Assess root architecture changes that may compensate for altered water transport

Based on studies of other CASP mutants, modifying Os01g0363300 expression could potentially alter the timing and extent of suberin deposition in the endodermis, which would affect radial water movement in the roots . These approaches provide a pathway for translating molecular understanding of Os01g0363300 into tangible improvements in rice drought tolerance.

How does Os01g0363300 function relate to nutrient use efficiency in rice?

The Casparian strip functions as a critical barrier controlling the selective uptake of nutrients, making Os01g0363300 potentially important for nutrient use efficiency. Research approaches should include:

  • Nutrient uptake analysis:

    • Compare uptake rates of various nutrients (N, P, K, Fe, Zn) in wild-type versus Os01g0363300 modified lines

    • Use radioactive or stable isotope tracers to track nutrient movement pathways

    • Examine whether Os01g0363300 affects specific nutrient transporters' activity

  • Gene expression integration:

    • Conduct co-expression analysis to identify nutrient transporters coordinated with Os01g0363300

    • Profile transcriptional changes in nutrient transport genes in Os01g0363300 mutants

    • Examine if Os01g0363300 expression responds to different nutrient availabilities

  • Physiological measurements:

    • Determine nutrient utilization efficiency (biomass produced per unit of nutrient)

    • Measure nutrient partitioning between roots and shoots

    • Analyze nutrient remobilization during grain filling

  • Multi-environment testing:

    • Evaluate performance in high vs. low nutrient conditions

    • Test interactions with beneficial microorganisms that affect nutrient availability

Research has shown that several CASP-like genes, including OsCASP_like2/3/13/17/21/30, may be involved in ion defect processes . This suggests that Os01g0363300 could potentially play a role in regulating ion homeostasis and nutrient uptake efficiency in rice.

What are the potential applications of CRISPR base editing for precise modification of Os01g0363300?

CRISPR base editing offers precise modification capabilities that could be valuable for functional studies of Os01g0363300:

  • Base editing approaches:

    • Cytosine base editors (CBEs) can create C→T transitions

    • Adenine base editors (ABEs) can create A→G transitions

    • Prime editing can introduce small insertions, deletions, or all possible substitutions

  • Target modifications:

    • Create specific amino acid substitutions to identify critical residues

    • Modify regulatory elements to alter expression patterns

    • Introduce premature stop codons for truncation studies

  • Multiplexed editing:

    • Simultaneously modify Os01g0363300 and related CASP genes to overcome redundancy

    • Edit Os01g0363300 along with interacting partners to study protein-protein interactions

    • Create allelic series with varying levels of functionality

  • Methodological considerations:

    • Design plant-optimized base editors with improved efficiency

    • Use tissue-specific promoters to drive base editor expression

    • Implement inducible systems for temporal control of editing

  • Validation approaches:

    • Deep sequencing to confirm editing efficiency and specificity

    • Whole-genome sequencing to detect potential off-target effects

    • Phenotypic analysis to confirm functional consequences of edits

These approaches allow for subtle modifications that maintain the reading frame and expression level of Os01g0363300 while altering specific functional aspects, providing more nuanced insights than traditional knockout strategies.

How might transcriptional regulation of Os01g0363300 be manipulated to enhance rice stress tolerance?

Understanding and manipulating the transcriptional regulation of Os01g0363300 offers opportunities for enhancing stress tolerance in rice:

  • Promoter analysis approaches:

    • Identify cis-regulatory elements in the Os01g0363300 promoter using bioinformatic tools

    • Perform promoter deletion analyses to map functional regulatory regions

    • Use chromatin immunoprecipitation (ChIP) to identify transcription factors binding to the promoter

  • Expression modification strategies:

    • Replace native promoter with stress-inducible promoters

    • Use synthetic promoters with optimized arrangements of cis-elements

    • Employ CRISPR activation (CRISPRa) to enhance expression during stress

  • Epigenetic regulation:

    • Analyze DNA methylation patterns of the Os01g0363300 promoter under different stresses

    • Investigate histone modifications associated with Os01g0363300 expression changes

    • Target epigenetic modifications using CRISPR-based epigenome editing

  • Transcription factor engineering:

    • Identify and modify transcription factors that regulate Os01g0363300

    • Create constitutively active versions of positive regulatory factors

    • Develop dominant negative versions of negative regulators

Analysis of cis-elements has indicated that most OsCASP and AtCASP genes contain MYB binding motifs , suggesting that MYB transcription factors may be key regulators that could be targeted for manipulation. This information provides a foundation for developing strategies to optimize Os01g0363300 expression under various stress conditions.

What high-throughput phenotyping approaches are most effective for characterizing Os01g0363300 mutants?

High-throughput phenotyping of Os01g0363300 mutants requires integrating multiple technologies:

  • Root phenotyping systems:

    • Transparent growth media systems (agar, hydroponic, or specialized growth pouches)

    • Automated root imaging platforms with time-lapse capabilities

    • 3D imaging using X-ray computed tomography for soil-grown plants

    • Light sheet microscopy for cellular-level phenotyping

  • Physiological measurements:

    • Automated systems for measuring transpiration and water use

    • Chlorophyll fluorescence imaging for photosynthetic efficiency

    • Thermal imaging to assess stomatal conductance

    • Hyperspectral imaging for nutrient status assessment

  • Digital image analysis workflows:

    • Machine learning algorithms for feature extraction from root images

    • Automated detection of Casparian strip defects using fluorescent markers

    • Time-series analysis of growth parameters

  • Data integration frameworks:

    • Multivariate statistical approaches to correlate multiple phenotypic traits

    • Network analysis to identify relationships between molecular and phenotypic data

    • Predictive modeling using phenotypic and genotypic data

  • Field phenotyping approaches:

    • Drone-based imaging for canopy temperature and vigor assessment

    • Ground-based phenotyping vehicles with multiple sensors

    • Wireless sensor networks for continuous monitoring

These approaches enable comprehensive characterization of subtle phenotypic changes that may result from modifications to Os01g0363300 and provide the data volume necessary for robust statistical analysis of its functions in rice.

How can computational modeling help predict the impact of Os01g0363300 modifications on root barrier function?

Computational modeling offers powerful approaches to predict how modifications to Os01g0363300 might affect root barrier function:

  • Protein structure modeling:

    • Predict structural changes resulting from mutations using homology modeling

    • Molecular dynamics simulations to assess protein stability and interactions

    • Protein-protein docking to model interactions with other CASP proteins

  • Cellular-level modeling:

    • Agent-based models of Casparian strip formation incorporating CASP dynamics

    • Spatial modeling of barrier development in endodermal cells

    • Diffusion models to predict solute movement through imperfect barriers

  • Tissue-level transport models:

    • Finite element modeling of water and solute transport across root tissues

    • Network models representing apoplastic and symplastic transport pathways

    • Integration of anatomical data with transport parameters

  • Whole-plant physiological models:

    • Systems biology approaches linking molecular changes to physiological outcomes

    • Crop models incorporating modified water and nutrient uptake parameters

    • Sensitivity analysis to identify critical parameters affecting plant performance

  • Data integration frameworks:

    • Machine learning approaches to predict phenotypes from molecular data

    • Bayesian networks to integrate different data types and handle uncertainty

    • Multi-scale modeling linking molecular changes to field-level outcomes

These computational approaches can generate testable hypotheses about the consequences of Os01g0363300 modifications, guide experimental design, and help interpret complex experimental results by providing mechanistic frameworks for understanding.

How does research on Os01g0363300 contribute to our broader understanding of plant adaptation mechanisms?

Research on Os01g0363300 contributes significantly to our understanding of plant adaptation mechanisms through several key insights:

  • Barrier formation principles: Studies of CASP proteins like Os01g0363300 have revealed fundamental principles about how plants form selective barriers critical for survival. The organization of CASP proteins into a stable membrane domain that recruits cell wall modification enzymes represents a conserved mechanism for creating cellular barriers .

  • Environmental interface regulation: The Casparian strip represents a critical interface between plants and their environment. Understanding how Os01g0363300 contributes to this barrier provides insights into how plants regulate water and nutrient uptake in response to environmental challenges.

  • Stress signaling integration: Research on CASP-related components has uncovered unexpected roles in stress signaling. For example, the receptor-like kinase SGN3 not only helps position CASPs but also appears to monitor barrier integrity and signal when defects are detected . Similar surveillance mechanisms might exist for Os01g0363300.

  • Evolutionary adaptation insights: Comparative analysis of CASP genes across species reveals how these critical barrier components have evolved, with evidence of whole genome duplication and tandem duplication events driving their diversification . This evolutionary perspective helps understand how plants have adapted to diverse environments.

  • Translational research potential: Findings from Os01g0363300 research can inform strategies for improving crop resilience to environmental stresses, particularly those related to water and nutrient availability.

By integrating molecular, cellular, and physiological approaches to studying Os01g0363300, researchers gain a more comprehensive understanding of the sophisticated mechanisms plants have evolved to adapt to environmental challenges.

What are the most promising interdisciplinary approaches for studying Os01g0363300 function?

The most promising interdisciplinary approaches for studying Os01g0363300 function integrate multiple scientific disciplines:

  • Molecular biology and structural biology:

    • Combining protein crystallography with in vivo functional studies

    • Integrating cryo-electron microscopy with genetic manipulation

    • Using nuclear magnetic resonance (NMR) to study protein-protein interactions

  • Cell biology and physics:

    • Applying biophysical techniques to measure membrane properties in CASP domains

    • Using advanced microscopy techniques like super-resolution microscopy and light sheet microscopy

    • Implementing microfluidic devices to control cellular microenvironments

  • Physiology and systems biology:

    • Combining multi-omics approaches (transcriptomics, proteomics, metabolomics)

    • Developing mathematical models linking molecular changes to physiological outcomes

    • Using network analysis to identify regulatory hubs and feedback mechanisms

  • Computational biology and artificial intelligence:

    • Applying machine learning to predict protein interactions and functions

    • Using deep learning for image analysis of complex cellular phenotypes

    • Implementing natural language processing to mine scientific literature for hypotheses

  • Engineering and synthetic biology:

    • Creating synthetic CASP variants with novel properties

    • Developing optogenetic tools to control CASP localization and function

    • Designing biomimetic barriers based on CASP properties for agricultural applications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.