Recombinant Oryza sativa subsp. japonica CASP-like protein Os01g0725400 (Os01g0725400, LOC_Os01g52610)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Os01g0725400; LOC_Os01g52610; OsJ_03314; P0022F10.36; P0042A10.11; CASP-like protein 3A1; OsCASPL3A1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os01g0725400
Target Protein Sequence
MGSIGNGRNGSEVGIQIPAMGNKEVLERPAIPRWPRLGVVMVATRAVALVMAVLSMALMI SAKQRGSLKIFGIEIPLYANWSFSDSLEYLVGMSAVSAAYCLAQLLLTAHKAVKNAPVVQ SRNYAWLLFTGDQIFAYAMMSAGSAAAAVANLNRTGIRHTALPNFCKPLPRFCDLSAASI ACAFLSCIFLAASAVIDVIWLSNM
Uniprot No.

Target Background

Database Links

KEGG: osa:4324725

UniGene: Os.33816

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of CASP-like protein Os01g0725400 in rice?

CASP-like proteins in rice, including Os01g0725400, are involved in Casparian strip formation and suberin deposition. The Casparian strip represents a specialized cell wall modification in the endodermis of plant roots that controls the movement of water and nutrients between tissues. Based on studies of similar proteins in rice, CASP proteins orchestrate Casparian strip formation and contribute to suberin deposition patterns in the root endodermis and sclerenchyma . These proteins form a transmembrane scaffold that recruits lignin biosynthetic enzymes necessary for proper Casparian strip development, which is essential for maintaining nutrient homeostasis and environmental stress adaptation.

How does Os01g0725400 compare structurally to other CASP proteins?

Based on comparative analysis, Os01g0725400 belongs to the CASP protein family that typically features a four-membrane-span structure . While the specific sequence of Os01g0725400 is not fully detailed in current literature, other rice CASP proteins show high sequence similarity to Arabidopsis thaliana CASPs (AtCASPs), suggesting conserved structural domains . The protein likely contains transmembrane domains that allow it to form a stable matrix at the Casparian strip membrane domain (CSD), establishing a platform for subsequent lignification machinery recruitment.

What expression patterns does Os01g0725400 exhibit in rice tissues?

While specific expression patterns for Os01g0725400 are not comprehensively documented, related rice CASP proteins show distinctive tissue-specific expression. For instance, OsCASP1 demonstrates high expression in small lateral root (SLR) tips and younger roots, moderate expression in primary root tips, and weak expression in leaves . Expression is typically concentrated in the stele of roots and can be strongly induced by environmental stressors, particularly salt stress, with enhanced expression in both stele and sclerenchyma tissues under these conditions .

How do mutations in CASP genes affect rice phenotype and stress tolerance?

Loss-of-function mutations in rice CASP genes result in several physiological and morphological abnormalities. Studies of OsCASP1 mutants reveal delayed Casparian strip formation and uneven lignin deposition in small lateral roots . These alterations disrupt normal barrier function in roots, leading to nutrient uptake abnormalities and ion imbalance throughout the plant. Phenotypically, mutants display withered leaves, reduced tillering capacity, and significantly decreased tolerance to salt stress . The absence of functional CASP proteins alters expression patterns of genes involved in suberin biosynthesis and changes the deposition patterns of suberin in both endodermal and sclerenchyma tissues.

What molecular mechanisms regulate the function of CASP proteins in Casparian strip formation?

The molecular regulation of CASP proteins involves multiple pathways and protein interactions. In Arabidopsis, transcription factor MYB36 controls the expression of genes involved in Casparian strip establishment . After localization to the Casparian strip membrane domain, CASP proteins recruit several secreted proteins essential for lignification, including ENHANCED SUBERIN 1 (ESB1), Peroxidase 64 (PER64), and RESPIRATORY BURST OXIDASE HOMOLOG F (RbohF) . The integrity of the Casparian strip is continuously monitored by diffusible peptides (Casparian strip integrity factors CIF1/2) produced in the vasculature. In rice, three OsMYB36 members redundantly regulate multiple genes implicated in Casparian strip formation at the root endodermis .

How does environmental stress modulate CASP protein expression and function?

Environmental stressors, particularly salt stress, significantly influence CASP protein expression and function in rice. Research has demonstrated that salt treatment strongly induces CASP gene expression in roots and leaves . This upregulation is especially pronounced in the stele and sclerenchyma cells of roots, suggesting a critical role for CASP proteins in stress adaptation. The induction of CASP expression likely represents a physiological response mechanism that reinforces barrier properties of root tissues under unfavorable environmental conditions, helping to maintain ion homeostasis and prevent toxic ion accumulation in sensitive plant tissues.

What expression systems are optimal for producing recombinant Os01g0725400?

For recombinant expression of Os01g0725400, T7 promoter-based expression systems in Escherichia coli represent an effective approach. Vectors such as pET21b can be employed for heterologous expression, with protocols optimized for rice proteins . When designing expression constructs, researchers should consider codon usage optimization, as different organisms exhibit varying preferences for specific codons that can significantly impact expression efficiency . The recombinant protein should include appropriate tags (such as His-tag) for purification and detection purposes, with expression conditions optimized through temperature, induction time, and media composition adjustments.

How can researchers generate antibodies against Os01g0725400?

Generating antibodies against Os01g0725400 requires using recombinant Oryza sativa subsp. japonica Os01g0725400 protein as an immunogen. Polyclonal antibodies can be raised in rabbits following standard immunization protocols . After collection, antibodies should undergo antigen affinity purification to enhance specificity. Optimal storage conditions include maintaining purified antibodies at -20°C or -80°C in an appropriate buffer system (e.g., 50% Glycerol, 0.01M PBS, pH 7.4 with 0.03% Proclin 300 as preservative) . These antibodies can be utilized for various applications including ELISA, Western blotting, and immunohistochemistry to study Os01g0725400 expression and localization.

What methods can be employed to study Os01g0725400 localization in rice tissues?

To investigate the cellular localization of Os01g0725400, researchers should consider generating transgenic rice lines expressing Os01g0725400 fused to reporter genes (GUS or GFP) under its native promoter. This approach allows visualization of tissue-specific expression patterns and subcellular localization . The construction of these reporter fusions can be accomplished using In-Fusion cloning techniques as described for similar proteins . Both cross-sectional and longitudinal examination of roots after appropriate staining procedures can provide detailed spatial information about protein distribution. Confocal microscopy of GFP-tagged proteins offers additional resolution for subcellular localization studies.

What staining techniques can visualize Casparian strip alterations in Os01g0725400 mutants?

Multiple staining approaches can assess the impact of Os01g0725400 mutations on Casparian strip formation and integrity:

These staining techniques should be applied to both wild-type and mutant roots to identify differences in Casparian strip structure, formation timing, and integrity . The comparison can reveal how Os01g0725400 dysfunction affects these critical barrier structures.

What cloning strategies are recommended for working with Os01g0725400?

For efficient cloning and expression of Os01g0725400, researchers should consider the OLIVAR system and vectors like pGRASS (Green fluorescent protein Reporter from Antisense promoter-based Screening System) . This approach integrates selection and expression cassettes in opposite orientations, allowing effective screening of positive recombinant clones. For amplification and construct preparation, In-Fusion cloning kits provide seamless, directional cloning without requiring specific restriction sites . When designing constructs for complementation studies, include both the native promoter (approximately 1-1.5 kb upstream of the gene) and the complete coding sequence to ensure proper expression patterns.

How can researchers generate and characterize Os01g0725400 mutants?

To generate Os01g0725400 mutants, researchers can employ several strategies:

  • Map-based cloning approaches can identify natural mutants with altered Os01g0725400 function

  • CRISPR-Cas9 gene editing can create targeted mutations in the Os01g0725400 locus

  • RNA interference (RNAi) or artificial microRNA techniques can reduce Os01g0725400 expression

Characterization of mutants should include comprehensive phenotypic analysis examining:

  • Root anatomical structure through cross-sectional analysis

  • Casparian strip formation timing and integrity using appropriate staining techniques

  • Suberin deposition patterns in endodermis and sclerenchyma

  • Stress response phenotypes, particularly under salt stress conditions

  • Ion content analysis to assess nutrient homeostasis disruption

  • Complementation tests by introducing wild-type Os01g0725400 to confirm gene function

What techniques can identify Os01g0725400 interaction partners?

To determine the protein interaction network of Os01g0725400, researchers should employ multiple complementary approaches:

  • Yeast two-hybrid screening using Os01g0725400 as bait against a rice cDNA library

  • Co-immunoprecipitation with tagged Os01g0725400 followed by mass spectrometry analysis

  • Bimolecular fluorescence complementation in plant cells to confirm interactions in vivo

  • Pull-down assays using recombinant Os01g0725400 protein to identify direct binding partners

Based on knowledge from Arabidopsis systems, potential interaction partners may include proteins involved in lignin biosynthesis, suberin deposition, and other components of the Casparian strip formation machinery . Key candidates include peroxidases, dirigent proteins, and regulatory factors such as MYB transcription factors that control Casparian strip development.

How does Os01g0725400 function differ between primary and lateral roots?

Research on related CASP proteins suggests potentially significant functional differences between primary and lateral roots. OsCASP1, for example, shows particularly high expression in small lateral root tips compared to primary roots . This differential expression pattern likely reflects the distinct developmental programs and functional requirements of different root types in rice. Lateral roots may require more rapid or specialized Casparian strip formation for optimal nutrient uptake and stress responses. To investigate these differences for Os01g0725400 specifically, researchers should perform comparative expression analysis, microscopic examination of Casparian strip formation timing, and functional studies in different root types under various environmental conditions.

How can understanding Os01g0725400 function contribute to improving rice stress tolerance?

Knowledge of Os01g0725400's role in Casparian strip formation and stress responses provides valuable insights for crop improvement strategies. Since CASP proteins contribute significantly to salt stress tolerance in rice , manipulating Os01g0725400 expression or activity could enhance crop resilience in saline environments. Potential applications include:

  • Developing rice varieties with optimized Os01g0725400 expression for improved nutrient use efficiency

  • Engineering enhanced salt tolerance through targeted modifications of the Os01g0725400 gene

  • Using Os01g0725400 expression as a marker for selecting stress-resistant varieties

  • Applying knowledge of CASP-mediated barrier formation to improve nutrient retention in agricultural systems

These approaches could contribute to developing more resilient rice varieties capable of maintaining productivity under increasingly challenging environmental conditions, addressing global food security concerns in the face of climate change.

What comparative insights can be gained from studying CASP proteins across different plant species?

For instance, the timing and structure of Casparian strip development in rice differ from those in Arabidopsis, reflecting distinct environmental adaptations . Cross-species comparisons provide insights into how CASP proteins have evolved to support diverse plant lifestyles and environmental niches. This evolutionary perspective enhances our understanding of fundamental plant adaptation mechanisms and supports the development of targeted improvement strategies for various crop species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.