Recombinant Oryza sativa subsp. japonica CASP-like protein Os02g0134500 (Os02g0134500, LOC_Os02g04180)

Shipped with Ice Packs
In Stock

Description

Expression Patterns

  • Os02g0134500 transcripts are downregulated under certain stress conditions but upregulated in others (e.g., fold changes: -4.45 to +7.15 in RNA-seq data), indicating context-dependent regulation .

  • Phylogenetic analysis groups Os02g0134500 within the CASP_like-I subfamily, which is closely related to canonical CASPs involved in barrier formation .

Experimental Use Cases

  • Barrier Function Studies: Useful for investigating Casparian strip formation via lignin deposition assays .

  • Stress Adaptation: Potential marker for salt or drought tolerance mechanisms in rice .

  • Protein-Protein Interaction: His tag facilitates pull-down assays to identify binding partners (e.g., peroxidases or transporters) .

Technical Considerations

  • Stability: Hydrophilic nature (grand average hydropathicity >0) and low instability index (<40) suggest robust biochemical handling .

  • Limitations: No direct functional studies on this recombinant form exist; inferences rely on homology to characterized CASPs .

Comparative Analysis of CASP Families

FeatureRice (OsCASP)Arabidopsis (AtCASP)
Gene Count41 members39 members
Key SubfamiliesCASP_like-I/II/IIICASP_like-I/II/III
Chromosomal DistributionHighest on Chr1/12Highest on Chr2/5
Root ExpressionOsCASP_like11/19AtCASP_like1/31

Os02g0134500 clusters within the conserved CASP_like-I subfamily, which shows root-specific expression and involvement in ion absorption . Its synteny with Arabidopsis genes suggests evolutionary conservation of function.

Future Directions

  • Functional Validation: CRISPR/Cas9 knockout studies to assess roles in root barrier formation.

  • Omics Integration: Co-expression analysis with lignin biosynthesis genes (e.g., peroxidases) .

  • Biotechnological Applications: Engineering rice varieties with enhanced nutrient use efficiency via CASP modulation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Os02g0134500; LOC_Os02g04180; OsJ_05284; CASP-like protein 4A2; OsCASPL4A2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os02g0134500
Target Protein Sequence
MALEAQPSPSPSPRRSPEAAAGGAGAPGGSAGDADAQARRATSGRPRRRGPQPRRSPPPP FPRTPRPSSAARTGKPVSPPPPPRKKPQFQPPPQPPRAWDPSPPPPPPAPAAPVLVPPPA PAPRPAPAPAPRVPARAVEHDHRVVPDILLRKRPTAVLQRTALVARVAAALLCLAALAVL AADSRKGFALDSYSNYSQLRYSEAVNVIGFVYSVLQFFVLADLMRRNKHLNPRRKGDYFD FFMDQVLAYLLISSSSSATARVGDWIDNWGSDPFPKMANSSIAISFMAFLVFAISALISA YNLFRRDI
Uniprot No.

Target Background

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.