Recombinant Oryza sativa subsp. japonica CASP-like protein Os02g0219900 (Os02g0219900, LOC_Os02g12760)

Shipped with Ice Packs
In Stock

Description

Role in Casparian Strip Formation

Os02g0219900 is a homolog of Arabidopsis CASP proteins, which orchestrate Casparian strip (CS) assembly in root endodermal cells . CS is a lignin-based barrier critical for selective mineral nutrient uptake and ion homeostasis . Studies show that OsCASP1 (Os02g0219900) is highly expressed in small lateral root tips and stele tissues under salt stress, where it regulates CS formation and prevents ectopic suberin deposition .

Stress Response Mechanisms

  • Salt Stress: Os02g0219900 expression is upregulated in roots and leaves under NaCl treatment, suggesting a role in ion balance maintenance .

  • Cold Tolerance: Orthologs like AtCASPL4C1 in Arabidopsis negatively regulate cold tolerance, with knock-out mutants exhibiting enhanced growth under low temperatures .

Functional Redundancy and Genetic Interactions

  • Loss of OsCASP1 function delays CS formation but increases lignin biosynthesis gene expression (e.g., OsPER64, OsLOTR1), indicating compensatory mechanisms .

  • Phylogenetic analysis groups Os02g0219900 within the CASP_like-I subfamily, alongside AtCASP1/3, which are essential for CS integrity .

Expression Dynamics

  • Tissue Specificity: Highest expression in small lateral roots and root tips, moderate in primary roots, and low in leaves .

  • Inducibility: Strong induction by NaCl and cold stress .

Molecular Studies

  • Protein-Protein Interactions: Used to study CASP family interactions with lignin biosynthesis enzymes .

  • Subcellular Localization: GFP-fusion constructs confirm plasma membrane localization .

Agricultural Biotechnology

  • Nutrient Uptake Optimization: Targeting Os02g0219900 could enhance rice resilience to saline soils by improving ion selectivity .

  • Stress Tolerance Engineering: Modulating CASP expression may improve cold tolerance in crops .

Future Directions

Current research gaps include:

  1. Structural characterization of Os02g0219900’s transmembrane domains .

  2. Mechanistic links between CASPs and suberin biosynthesis pathways .

  3. Field trials to validate CRISPR-edited OsCASP1 rice lines under abiotic stress .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For working aliquots, store at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your own formulations.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development accordingly.
Synonyms
Os02g0219900; LOC_Os02g12760; B1131G07.1; OsJ_005746; P0027A02.30; CASP-like protein 2D1; OsCASPL2D1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os02g0219900
Target Protein Sequence
MRSGEGSTAAAAAAEEEKVKVAAPFRLAELGLRVCAVPLAVASVWEMATNKQVDETYGEV RFSDLSGFRYLVWINAITAAYSVASILLSSCRFITRFDWLIFLLDQASAYLLLTSASAAA EVVYLAREGDREVSWGEVCSYFGRFCGAATVSVALNAAALLCFMALSLISAFRVFTKFNP PSQSNSKQQLSQEQGKPVVSG
Uniprot No.

Target Background

Database Links
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the fundamental function of CASP-like proteins in rice?

CASP-like proteins in rice (Oryza sativa) function primarily as transmembrane scaffolds that recruit lignin biosynthetic enzymes for Casparian strip (CS) formation. In rice, which has a more complex root structure than Arabidopsis, CASP proteins are essential for the proper deposition of lignin and suberin in root tissues. These processes are critical for controlling nutrient uptake, maintaining ion homeostasis, and enabling adaptation to growth environments, particularly in response to stresses like salinity . Rice CASP1 (OsCASP1) has been demonstrated to play a vital role in nutrient homeostasis and environmental adaptation through its regulation of these barrier-forming structures in roots.

What expression systems are most effective for producing recombinant rice CASP-like proteins?

For optimal expression of recombinant rice CASP-like proteins, the In-Fusion cloning system has proven effective, as demonstrated with OsCASP1. The recommended methodology involves:

  • PCR amplification of the complete gene sequence and native promoter region

  • Construction of expression vectors using pCAMBIA-1300 for plant transformation or bacterial expression systems

  • Creation of fusion constructs (such as GUS fusions) for localization studies using vectors like pCXGUS-P

Expression SystemVectorAdvantagesApplications
Plant-basedpCAMBIA-1300Native post-translational modificationsIn vivo functional studies
BacterialpET seriesHigh yield, rapid productionProtein purification, antibody production
YeastpYES2Eukaryotic modificationsComplex protein studies

How can I determine the subcellular localization of CASP-like proteins in rice tissues?

Based on methodologies used with OsCASP1, effective approaches include:

  • GUS reporter assays: Generate promoter:gene-GUS fusion constructs to visualize expression patterns in different tissues and under varying conditions

  • Cross-sectional analysis: Prepare thin sections of roots at different developmental stages and regions for microscopic examination

  • Immunolocalization: Use specific antibodies against the CASP-like protein of interest

  • Fluorescent protein fusions: Create GFP or other fluorescent protein fusions for live imaging

The localization pattern may vary significantly depending on environmental conditions. For example, OsCASP1 shows high expression in small lateral root (SLR) tips, and this expression increases under salt stress conditions, particularly in the stele tissues .

How do rice CASP-like proteins differ functionally from their Arabidopsis counterparts?

While rice CASP proteins share sequence similarity with Arabidopsis CASPs, they exhibit several distinctive characteristics:

FeatureRice CASP1Arabidopsis CASPs
Expression patternConcentrated in SLR tips; inducible by salt stressBroader endodermal expression
CS formation timingLater developmental stage than ArabidopsisEarlier in root development
Root structure complexityAdapts to semi-aquatic conditionsAdapted to terrestrial growth
Response to stressStrong induction under salt stressLess pronounced stress response

The appearance time and structure of Casparian strips in rice roots differ significantly from those in Arabidopsis. Rice CASP1, while sharing sequence similarity with AtCASPs, shows distinct expression patterns and stress responses. Loss of OsCASP1 function leads to delayed CS formation, uneven lignin deposition, and altered suberin patterns in small lateral roots, resulting in ion imbalance, withered leaves, fewer tillers, and decreased salt tolerance .

What experimental design is most effective for studying CASP-like protein roles in abiotic stress responses?

Based on published research with OsCASP1, an effective experimental design would include:

  • Stress exposure protocols:

    • Salt stress: Treat seedlings with 100 mM NaCl for specific durations (e.g., 3 hours) to induce expression changes

    • Monitor expression using GUS reporter assays and RT-qPCR

    • Examine tissue-specific responses through cross-sectional analysis

  • Genetic manipulation approaches:

    • Generate knockout/knockdown lines using CRISPR-Cas9 or RNAi

    • Create overexpression lines under constitutive or inducible promoters

    • Develop complementation lines to confirm gene function

  • Phenotypic analysis:

    • Histochemical staining to detect changes in lignin and suberin deposition patterns

    • Ion content measurement to assess nutrient uptake and homeostasis

    • Root architecture analysis, including lateral root development

    • Growth parameters assessment (tiller number, leaf morphology, biomass)

How can computational approaches aid in predicting CASP-like protein structure and function?

Computational approaches, particularly those employing advanced AI systems like DeepMind's AlphaFold, offer powerful tools for CASP-like protein analysis:

  • Structure prediction: AlphaFold has demonstrated remarkable accuracy in the Critical Assessment of Structure Prediction (CASP) competition, suggesting it can reliably predict the 3D structure of CASP-like proteins based on amino acid sequences

  • Functional domain identification:

    • Identification of transmembrane domains characteristic of CASP proteins

    • Prediction of protein-protein interaction surfaces

    • Recognition of conserved motifs across species

  • Evolutionary analysis:

    • Paralog identification within the rice genome

    • Ortholog comparison across plant species

    • Lineage-specific adaptation analysis

For rice proteins specifically, comparative analyses between rice and Arabidopsis have revealed that both genomes possess lineage-specific genes while sharing similar sets of predicted functional domains. This suggests that computational approaches can identify both conserved functional elements and species-specific adaptations in CASP-like proteins .

What mechanisms link CASP-like proteins to suberin deposition regulation in rice roots?

Research on OsCASP1 has revealed complex relationships between CASP proteins and suberin deposition:

  • The loss of OsCASP1 function alters:

    • Expression of genes involved in suberin biosynthesis

    • Suberin deposition patterns in both endodermis and sclerenchyma tissues

    • Timing and location of lignin deposition in Casparian strips

  • Regulatory mechanisms appear to involve:

    • Proper scaffolding for enzyme recruitment

    • Coordinated expression of biosynthetic genes

    • Spatial organization of deposition machinery

What proteomic approaches are most suitable for studying CASP-like protein interactions?

Based on rice proteome research methodologies, effective approaches include:

  • Two-dimensional electrophoresis (2-DE) on pH 4-7 gels, which has successfully resolved 480 reproducible protein spots in rice seed studies

  • Mass spectrometry:

    • MALDI-TOF MS for protein identification

    • LC-MS/MS for more complex samples and post-translational modification analysis

  • Bioinformatic analysis:

    • Hydropathy plot analysis to characterize physicochemical properties

    • Gene ontology classification to identify functional relationships

    • Interaction network mapping

These approaches can reveal hydrophilicity profiles, binding partners, and metabolic pathway involvement. In rice seed proteome studies, most proteins identified were hydrophilic and related to binding, catalytic, cellular, or metabolic processes , suggesting similar approaches would be valuable for CASP-like protein characterization.

How should recombinant DNA experiments with rice CASP-like proteins be managed for regulatory compliance?

According to institutional biosafety guidelines, research involving recombinant CASP-like proteins requires:

  • Regulatory oversight:

    • Submit detailed proposals to the Institutional Biosafety Committee (IBC)

    • Ensure compliance with NIH, CDC, USDA, and HHS regulations

    • Follow applicable Select Agent Regulations when necessary

  • Appropriate biosafety measures:

    • Typically BSL-1 or BSL-2 containment based on risk assessment

    • BSL-2 containment for work involving biohazardous materials with moderate potential hazard to personnel and environment

  • Plant-specific considerations:

    • Follow guidelines in Biosafety in Microbiological and Biomedical Laboratories (BMBL)

    • Adhere to NIH Guidelines Section III and Appendix P for plants

The primary goal of these measures is to minimize risks to faculty, staff, students, facilities, community, and environment while enabling valuable research to proceed.

What comparative genomic approaches help characterize evolutionary relationships of CASP-like proteins?

Effective comparative genomic methodologies include:

  • Ortholog identification:

    • BLASTP searches against combined protein datasets from multiple species

    • Identification of reciprocal best hits with E-values <10^-5

  • Evolutionary distance calculation:

    • Sequence alignment using CLUSTALW

    • Distance estimation using Poisson-γ correction with shape parameter of 2.25

    • Analysis of branch lengths to determine divergence patterns

  • Lineage-specific duplication analysis:

    • Statistical tests such as Z-test to determine if paralogs arose after species divergence

    • Assessment of selection pressure through analysis of synonymous vs. non-synonymous substitutions

These approaches have revealed that natural selection appears to play a role in duplicated genes across species, with duplication events either suppressed or favored depending on gene function .

How can contradictory experimental results regarding CASP-like protein function be reconciled?

To resolve conflicting data about CASP-like protein function, implement a multi-faceted approach:

  • Technical validation:

    • Employ multiple independent techniques to confirm findings

    • Standardize experimental conditions across studies

    • Verify antibody specificity and construct functionality

  • Genetic context consideration:

    • Create isogenic lines differing only in the CASP gene variant

    • Perform comparative studies across rice subspecies and varieties

    • Test for genetic background effects through crossing experiments

  • Environmental influence assessment:

    • Evaluate protein function under precisely controlled growth conditions

    • Test various stress parameters including duration, intensity, and timing

    • Consider developmental stage effects on observed phenotypes

  • Mechanistic investigation:

    • Identify protein interaction partners under different conditions

    • Analyze post-translational modifications across experimental scenarios

    • Examine subcellular localization changes in response to varying stimuli

This systematic approach helps distinguish genuine biological variation from methodological discrepancies, providing a more comprehensive understanding of CASP-like protein function across different rice varieties and environmental conditions.

What emerging technologies hold promise for advancing rice CASP-like protein research?

Several cutting-edge approaches are poised to transform our understanding of rice CASP-like proteins:

  • CRISPR base editing for precise manipulation of protein domains without complete gene disruption

  • Single-cell transcriptomics to resolve cell-type specific expression patterns in complex root tissues

  • Advanced live imaging techniques to visualize protein localization dynamics in response to environmental changes

  • Structural biology approaches informed by AI predictions to elucidate protein-protein interaction mechanisms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.