Recombinant Oryza sativa subsp. japonica CASP-like protein Os02g0578333 (Os02g0578333, LOC_Os02g36845)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Plants

The Casparian strip membrane domain (CSD) proteins, including Os02g0578333, are essential for:

  • Root Endodermal Barrier Formation: Mediating localized lignin deposition to create apoplastic barriers that regulate ion and water transport .

  • Membrane Scaffolding: Stabilizing plasma membrane domains to restrict diffusion of lipids and proteins .

  • Stress Response: Modulating cold tolerance and growth dynamics, as observed in orthologs like AtCASPL4C1 in Arabidopsis .

Comparative Insights:

  • Rice Os02g0578333 shares homology with Arabidopsis CASPLs (e.g., AtCASPL4C1), but functional divergence exists. For example, AtCASPL4C1 knockouts show enhanced biomass and cold tolerance, while overexpression suppresses growth .

  • Phylogenetic analysis groups Os02g0578333 within the CASP_like-I subfamily, suggesting conserved roles in endodermal development .

Expression and Purification

  • Host: E. coli .

  • Tag: N-terminal His tag for affinity chromatography .

  • Storage: -20°C/-80°C in aliquots to avoid freeze-thaw cycles .

Research Applications

ApplicationDescription
Structural StudiesUsed to investigate transmembrane domain organization and membrane scaffolding .
Functional AssaysEmployed in lignin deposition studies and ion permeability assays .
Antibody DevelopmentServes as an antigen for generating antibodies to study CASPL localization .

Table 1: Functional Insights from Orthologs and Mutants

StudyOrganismKey Findings
AtCASPL4C1 Knockout ArabidopsisAccelerated growth, increased biomass, and enhanced cold tolerance.
OsCASP1 Mutant RiceAbnormal Casparian strip lignin deposition and altered ion permeability.
CASPL Phylogeny Rice/ArabidopsisOs02g0578333 clusters with CASP_like-I subfamily, linked to endodermal function.

Notable Observations:

  • Recombinant Os02g0578333 does not fully replicate native protein behavior due to truncation (1-201 aa vs. full-length 308 aa) .

  • Immunostaining studies suggest discrepancies in subcellular localization, necessitating further validation .

Challenges and Future Directions

  • Functional Redundancy: CASPLs exhibit genetic redundancy, complicating knockout studies .

  • Structural Dynamics: Full-length protein expression and post-translational modifications remain underexplored .

  • Biotechnological Potential: Engineering CASPLs could improve crop stress resilience and nutrient uptake efficiency .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate any specific format preferences you may have. Please indicate your desired format in the order notes and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs unless otherwise requested. If you require dry ice shipping, please communicate this to us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing of the protein is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We suggest incorporating 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life of the protein is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the protein at -20°C/-80°C. For multiple uses, aliquoting is necessary. To maintain optimal protein integrity, avoid repeated freeze-thaw cycles.
Tag Info
The specific tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Os02g0578366; LOC_Os02g36845; B1267B06.3; B1342F01.34; OsJ_07255; Casparian strip membrane protein 7; OsCASP7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os02g0578366
Target Protein Sequence
MEAGEEIEDGEPSTPTYKAHHPPPHLPPPMRSSGVSLVLSVADLVLRFVAIGGTAGSAIA MATTSETLPFAAPFVRFRAEYSDLPTLMFFVVASSVVCAYLVLSLPASVVHVVRPGARSS RAILAFLDTVMLALLTASASAAAAIVYLAHRGSARANWLGICQQFTSFCQRITASLVGSF AAAVVLVALVFLSALSLARRA
Uniprot No.

Target Background

Function
This protein plays a crucial role in regulating membrane-cell wall junctions and localized cell wall deposition. It is essential for establishing the Casparian strip membrane domain (CSD) and the subsequent formation of Casparian strips, a specialized cell wall modification within the root endodermis. This modification acts as an apoplastic barrier, effectively separating the intraorganismal apoplasm from the extraorganismal apoplasm and preventing lateral diffusion.
Database Links
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does Os02g0578333 relate to other CASP-like proteins in plants?

Os02g0578333 (OsCASP7) belongs to the broader family of CASP-like (CASPL) proteins that are conserved across the plant kingdom. Phylogenetic analysis reveals that CASPLs are homologous to the MARVEL protein family, showing conservation particularly in the transmembrane domains. The conservation pattern in these domains mirrors that seen in MARVEL proteins from stramenopiles and fungi, with characteristic basic (Arg, His, Lys) and acidic (Asp, Glu) amino acids in TM1 and TM3 respectively .

Rice (Oryza sativa) contains multiple CASP-like proteins that likely serve diverse functions in different tissues, with OsCASP7 being specifically involved in Casparian strip formation in root endodermis. The CASP family in rice represents part of a larger evolutionary story where these proteins have diverged to serve specialized functions while maintaining core structural features that define the family .

What expression system is typically used for producing recombinant Os02g0578333?

The recombinant Oryza sativa subsp. japonica CASP-like protein Os02g0578333 is typically produced using an in vitro E. coli expression system. This bacterial expression system offers several advantages for producing plant transmembrane proteins, including high yield, relatively simple purification protocols, and cost-effectiveness. The protein is commonly expressed with an N-terminal 10xHis tag to facilitate purification using affinity chromatography .

For optimal production, the protein is expressed as the full-length protein (1-201 amino acids) to maintain its structural integrity and functional properties. After expression and purification, the protein can be provided in liquid form or as a lyophilized powder. When lyophilized, it is typically prepared in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 to ensure stability during storage and reconstitution .

What is the significance of the conserved residues in the transmembrane domains of Os02g0578333 for protein function?

The conserved residues in the transmembrane domains of Os02g0578333, particularly the Arginine in TM1 and Aspartic acid in TM3, play crucial roles in the protein's function. These residues are highly conserved across the CASPL family and appear to be essential for proper protein localization and function. Evidence suggests that these transmembrane domains are involved in CASP localization to specific membrane domains, particularly the Casparian strip domain (CSD) in endodermal cells .

The conservation pattern suggests ionic interactions between the basic and acidic residues in different transmembrane helices, which may contribute to protein stability, oligomerization, or interactions with other membrane components. These interactions likely facilitate the formation of the specialized membrane domain that serves as a scaffold for the deposition of lignin and other cell wall components during Casparian strip formation. Mutation studies in related CASP proteins have shown that alterations to these conserved residues can disrupt proper localization and function, underscoring their importance for the protein's biological role .

How does the nine-amino acid signature in the first extracellular loop contribute to CASP function and tissue specificity?

The nine-amino acid signature (ESLPFFTQF) found in the first extracellular loop (EL1) of many CASP proteins, including members of the rice CASP family, plays a critical role in determining functional specificity and tissue localization. This highly conserved motif appears to be specifically associated with endodermis-specific expression and function in forming the Casparian strip .

Experimental evidence supports this functional role: when a Lotus japonicus CASP homolog containing this nine-amino acid signature was expressed in Arabidopsis under the control of its own putative promoter, it perfectly recapitulated the localization of the endogenous AtCASP1 at the Casparian strip domain (CSD). This observation suggests that the EL1 sequence serves an endodermis-specific function and that this conservation extends to regulatory elements controlling expression .

Interestingly, this signature is absent in plants lacking true Casparian strips, such as Physcomitrella patens and Selaginella moellendorffii, further supporting its specialized role. Additionally, in parasitic plants like Striga asiatica that have reduced root systems, CASP homologs encode premature stop codons, preventing the complete translation of the fourth transmembrane domain and likely rendering them nonfunctional. In contrast, facultative hemiparasites like Triphysaria pusilla retain functional CASP alleles with the conserved EL1 sequence .

This evolutionary pattern suggests that the nine-amino acid signature in EL1 represents a specialized adaptation for Casparian strip formation in the endodermis of vascular plants, and its presence or absence correlates with the developmental and functional requirements of different plant species.

What experimental design approaches are most effective for studying the membrane localization of Os02g0578333?

Studying the membrane localization of Os02g0578333 requires carefully designed experiments that account for the protein's transmembrane nature and specific localization patterns. A systematic experimental design approach should include:

The experimental approach should follow a randomized design when possible, particularly when comparing multiple constructs or treatments, to minimize the effects of extraneous variables. Additionally, sample sizes should be sufficiently large to account for biological variability, with appropriate statistical analyses planned before experimentation begins .

What methods are most effective for studying protein-protein interactions involving Os02g0578333?

Studying protein-protein interactions involving Os02g0578333 requires specialized approaches suitable for membrane proteins. The following methodological approaches are recommended:

  • Split-GFP/BiFC (Bimolecular Fluorescence Complementation): This technique involves fusing complementary fragments of a fluorescent protein to potential interaction partners. When Os02g0578333 interacts with another protein, the fragments come together to reconstitute the fluorescent protein, allowing visualization of the interaction in planta. This is particularly useful for membrane proteins as it preserves their native cellular context.

  • Co-immunoprecipitation with membrane solubilization: Using detergents optimized for membrane protein extraction (e.g., n-Dodecyl β-D-maltoside or digitonin) followed by pull-down with antibodies against Os02g0578333 or its tag. Mass spectrometry analysis of co-precipitated proteins can identify interaction partners.

  • Yeast two-hybrid membrane system: Specialized membrane yeast two-hybrid systems such as split-ubiquitin Y2H can be employed to detect interactions between membrane proteins. For Os02g0578333, this would involve creating fusion constructs that place the protein in the correct orientation relative to the membrane.

  • FRET (Förster Resonance Energy Transfer): By tagging Os02g0578333 and potential interaction partners with compatible fluorophores, interactions can be detected through energy transfer when the proteins are in close proximity (typically <10 nm).

  • Chemical cross-linking followed by mass spectrometry: This approach uses membrane-permeable cross-linking reagents to covalently link interacting proteins, followed by identification via mass spectrometry. This can capture even transient interactions between Os02g0578333 and other proteins.

When designing these experiments, it is crucial to include appropriate positive and negative controls, perform replicates for statistical validation, and consider the potential impact of tags or fusion proteins on the natural interaction behavior of Os02g0578333 .

How can researchers study the role of Os02g0578333 in Casparian strip formation?

To investigate the role of Os02g0578333 in Casparian strip formation, researchers should implement a comprehensive experimental approach that combines molecular, cellular, and physiological techniques:

  • Gene knockout/knockdown studies: CRISPR/Cas9-mediated mutagenesis or RNAi-based knockdown of Os02g0578333 in rice, followed by analysis of Casparian strip integrity. The Casparian strip can be visualized using propidium iodide staining or autofluorescence of lignin under UV light.

  • Complementation assays: Expressing Os02g0578333 in Arabidopsis casp mutants to assess functional conservation and the ability to rescue the phenotype. This approach was successfully used with Lotus japonicus CASP proteins, demonstrating functional conservation across species .

  • Lignin deposition analysis: Since Casparian strips involve localized lignin deposition, techniques such as Fluorol Yellow staining or immunolocalization with lignin-specific antibodies can reveal whether Os02g0578333 affects the proper spatiotemporal pattern of lignin deposition.

  • Barrier function assays: Measuring the permeability barrier function using tracer dyes such as propidium iodide or fluorescent molecules of different sizes. Defects in Os02g0578333 function would likely result in compromised barrier function of the endodermis.

  • Live imaging of protein dynamics: Using photoactivatable or photoconvertible fluorescent protein fusions to track the recruitment and dynamics of Os02g0578333 during Casparian strip formation in real-time.

  • Correlative microscopy: Combining fluorescence imaging of Os02g0578333 localization with electron microscopy to correlate protein localization with ultrastructural features of the Casparian strip.

These methodological approaches should be designed following proper experimental principles, including randomization, appropriate controls, and statistical analysis plans. By systematically studying the functional role of Os02g0578333 using these approaches, researchers can elucidate its specific contribution to Casparian strip formation in rice .

How does the evolutionary history of Os02g0578333 relate to the development of Casparian strips in plants?

The evolutionary history of Os02g0578333 provides fascinating insights into the development of Casparian strips across the plant kingdom. Phylogenetic analysis of CASP-like proteins reveals a correlation between the emergence of specialized CASP proteins and the development of functional Casparian strips in vascular plants .

CASP homologs with the characteristic nine-amino acid signature in the first extracellular loop (ESLPFFTQF) are absent in bryophytes like Physcomitrella patens and lycophytes like Selaginella moellendorffii, which lack true Casparian strips. This suggests that the specialized function of CASPs in Casparian strip formation emerged after the divergence of these early land plant lineages .

The evolutionary trajectory shows increasing specialization of CASP proteins in angiosperms, with rice (Oryza sativa) possessing multiple CASP homologs including Os02g0578333. This diversification likely reflects functional specialization for different tissues or developmental stages. Interestingly, evolutionary modifications of CASP genes correlate with changes in root anatomy and function:

  • In parasitic plants with reduced root systems (e.g., Striga asiatica), CASP homologs contain premature stop codons that prevent complete protein translation, likely rendering them nonfunctional .

  • In carnivorous plants lacking true roots (e.g., Utricularia gibba), the conserved EL1 sequence is highly divergent, with only two residues identical to the Arabidopsis CASP EL1 stretch .

  • In facultative hemiparasites (e.g., Triphysaria pusilla) that retain functional roots, functional CASP alleles are maintained .

This evolutionary pattern suggests that Os02g0578333 and related CASP proteins represent specialized adaptations that co-evolved with the development of the endodermis and Casparian strip in vascular plants, with modifications or losses occurring in lineages where these structures were reduced or lost due to lifestyle changes.

What comparative analysis approaches can reveal functional differences between rice CASP proteins and those in other species?

To understand the functional differences between rice CASP proteins like Os02g0578333 and those in other species, researchers should employ a multi-faceted comparative analysis approach:

  • Sequence-based comparative analysis:

    • Alignment of transmembrane domains and extracellular/intracellular regions to identify species-specific variations

    • Analysis of selection pressure (dN/dS ratios) on different protein domains to identify regions under positive or purifying selection

    • Motif identification and conservation analysis, particularly focusing on the nine-amino acid signature in the first extracellular loop

  • Structural prediction and comparison:

    • Homology modeling based on related protein structures

    • Comparison of predicted protein-protein interaction interfaces

    • Analysis of conserved vs. variable residues in the context of the 3D structure

  • Expression pattern comparison:

    • Cross-species analysis of CASP gene expression in different tissues and developmental stages

    • Comparison of promoter regions to identify conserved regulatory elements

  • Functional complementation assays:

    • Expressing Os02g0578333 in Arabidopsis or other model species with CASP mutations

    • Testing the ability of CASP proteins from other species to complement rice casp mutants

  • Protein localization comparison:

    • Analysis of subcellular localization patterns of CASP proteins from different species when expressed in the same cellular context

    • Identification of species-specific differences in protein targeting or membrane domain association

These comparative approaches should be designed following proper experimental design principles, including controls for phylogenetic effects and accounting for differences in genomic context between species. Through systematic comparative analysis, researchers can identify the molecular determinants of functional divergence between rice CASP proteins and their homologs in other plant species .

What are the critical factors in designing experiments to study Os02g0578333 function in planta?

When designing experiments to study Os02g0578333 function in planta, researchers should consider several critical factors to ensure robust and reproducible results:

  • Genetic background selection:

    • Use appropriate rice varieties with well-characterized genetic backgrounds

    • Consider functional redundancy with other CASP family members in rice

    • Include wild-type controls from the same genetic background as mutant lines

  • Mutation/transgene design:

    • For knockout studies, target conserved regions like transmembrane domains

    • For overexpression, consider native vs. constitutive promoters

    • Design complementation constructs with proper tags that don't interfere with function

  • Experimental controls:

    • Include positive controls (e.g., known CASP mutants)

    • Use negative controls (e.g., empty vector transformants)

    • Consider using multiple independent transgenic/mutant lines to account for position effects

  • Growth conditions standardization:

    • Control environmental factors (light, temperature, humidity)

    • Standardize growth media composition, particularly for nutrient stress studies

    • Document growth stages precisely using standardized developmental scales

  • Phenotypic analysis methodology:

    • Define clear, quantifiable phenotypic parameters

    • Use multiple complementary techniques to assess Casparian strip integrity

    • Implement blinded analysis where possible to reduce experimenter bias

  • Statistical considerations:

    • Determine appropriate sample sizes through power analysis

    • Plan randomization strategies for plant selection and measurement

    • Pre-define statistical tests appropriate for the data type and distribution

  • Temporal aspects:

    • Consider developmental timing of Casparian strip formation

    • Include time-course analyses to capture dynamic processes

    • Account for potential environmental effects on developmental timing

By carefully considering these factors and implementing a true experimental design with proper controls and randomization, researchers can maximize the validity and reproducibility of studies on Os02g0578333 function in planta .

How should researchers design experiments to study the effect of environmental stresses on Os02g0578333 expression and function?

Designing experiments to study the effects of environmental stresses on Os02g0578333 expression and function requires a sophisticated approach that combines controlled stress treatments with molecular and physiological analyses:

Environmental StressTreatment RangeDurationKey Measurements
Salinity50-200 mM NaCl6h, 24h, 72h, 7dGene expression, protein localization, root conductivity
Drought10-30% PEG-60006h, 24h, 72h, 7dGene expression, ABA levels, water transport
Nutrient deficiency0-100% of normal levels3d, 7d, 14dElement profiles, Casparian strip integrity
Heavy metalsCd (5-50 μM), As (10-100 μM)24h, 72h, 7dMetal accumulation, barrier function
TemperatureHeat (35-42°C), Cold (4-10°C)6h, 24h, 72hMembrane integrity, protein stability

For a robust experimental design, researchers should:

  • Implement a factorial design: Test multiple stresses at different intensities and durations to identify interactions between factors. This approach allows for the identification of specific conditions that might uniquely affect Os02g0578333 expression or function .

  • Include appropriate controls:

    • Unstressed plants grown in parallel

    • Plants exposed to osmotic controls (for salt stress)

    • Recovery treatments where stress is removed

    • Mutants of known stress-responsive pathways

  • Measure multiple response variables:

    • Transcript levels of Os02g0578333 via RT-qPCR

    • Protein abundance via western blotting

    • Protein localization using fluorescent fusion proteins

    • Casparian strip integrity via propidium iodide permeability

    • Physiological parameters (root hydraulic conductivity, ion content)

  • Apply time-course analysis: Environmental responses often show complex temporal dynamics, so measuring responses at multiple time points is essential to capture transient or biphasic responses.

  • Validate findings across multiple independent experiments: Ensure reproducibility by conducting at least three independent biological replicates, with appropriate technical replication within each experiment.

  • Implement randomized block design: To control for potential positional effects in growth chambers or greenhouses, implement a randomized block design where treatments are randomly assigned within experimental blocks .

By following these design principles, researchers can generate robust data on how environmental stresses affect Os02g0578333 expression and function, providing insights into its role in stress adaptation in rice.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.