Recombinant Oryza sativa subsp. japonica CASP-like protein Os04g0684300 (Os04g0684300, LOC_Os04g58760)

Shipped with Ice Packs
In Stock

Description

Functional Role in Plant Physiology

Os04g0684300, also termed OsCASP1, regulates two critical processes:

  1. Casparian Strip Formation: Directs the assembly of CS membrane domains in endodermal cells, creating an apoplastic barrier to control ion diffusion .

  2. Nutrient Homeostasis: Mutants lacking OsCASP1 exhibit disrupted mineral balance (e.g., elevated Na⁺, Ca²⁺, Fe³⁺) and growth defects under soil/hydroponic conditions .

Key Mutant Phenotypes

ParameterWild TypeOsCASP1 Knockout (oscasp1)
CS FormationComplete endodermal CS by maturity Delayed/absent CS; ectopic suberin
Root ArchitectureNormal SLR development Reduced small lateral roots (SLRs)
Ion HomeostasisBalanced Na⁺/K⁺ ratios Elevated Na⁺, Fe³⁺; reduced K⁺

Expression and Localization

  • Tissue Specificity: Highly expressed in root elongation zones (3–6 mm from apex) .

  • Subcellular Localization:

    • Early stages: Uniform plasma membrane distribution in endodermal cells .

    • Maturation: Localizes to anticlinal membrane domains coinciding with CS lignin deposition .

Genetic and Physiological Impacts

  • Knockout Lines (e.g., oscasp1-1, oscasp1-3):

    • Exhibit withered leaves, reduced tillers, and stunted growth .

    • Show altered expression of CS-related genes (e.g., OsCASP2, OsPER64) .

  • Environmental Adaptation: OsCASP1 expression increases under salt stress, suggesting role in salinity tolerance .

Applications in Research

Recombinant Os04g0684300 facilitates:

  1. Mechanistic Studies: Elucidating CS assembly and membrane-cell wall junction dynamics .

  2. Protein Interaction Mapping: Identifying partners like OsCASP2 via co-expression assays .

  3. Stress Response Analysis: Testing ion transport under abiotic stress (e.g., salinity, heavy metals) .

Current research gaps include:

  • Structural resolution of OsCASP1’s transmembrane domains.

  • Engineering OsCASP1 variants for enhanced nutrient-use efficiency.

  • Cross-species functional studies to assess conservation in cereal crops.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Os04g0684300; LOC_Os04g58760; OsJ_015951; OSJNBa0088H09.7; Casparian strip membrane protein 1; OsCASP1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-224
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os04g0684300
Target Protein Sequence
MSSGEPAAVSIPIHDHHGKAPATSSAVPAAAAAAPAAAPAVAPRKVGIPFFRRGDHHRGS RCLAFLDFILRIAAFGPALAAAISTGTSDETLSVFTEFYQFRARFDDFPAFLFFLVANAI VAGYLVLSLPFSAVLVIRPQTIGLRLLLLVCDMIMAAMLTAAASAAAAIVDLAHNGNLRA NWVAICMQFHGFCQRTSGSVVASFLTVVILMFLVILAACSIRKR
Uniprot No.

Target Background

Function

Function: This protein regulates membrane-cell wall junctions and localized cell wall deposition. It is essential for establishing the Casparian strip membrane domain (CSD) and subsequent Casparian strip formation. Casparian strips are cell wall modifications in the root endodermis that create an apoplastic barrier between the intraorganismal and extraorganismal apoplasm, preventing lateral diffusion.

Database Links

KEGG: osa:4337453

UniGene: Os.58449

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is OsCASP1 and what is its genomic location in rice?

OsCASP1 is encoded by Os04g0684300 (also identified as LOC_Os04g58760) and belongs to the Casparian Strip Membrane Domain Protein family in rice (Oryza sativa subsp. japonica). It is located on chromosome 4 and was identified through map-based cloning. The gene was initially delimited to a region of approximately 265-kb between insertion-deletion molecular markers ID4-3 and ID4-10, and subsequently narrowed down to an 11.3-kb region between ID4-371 and ID4-3-8 using Indel markers . This region contained two genes - Os04g0684200 and Os04g0684300, with the latter encoding OsCASP1. Map-based cloning revealed a 15-bp deletion in the coding region of the Os04g0684300 gene in the mutant plants exhibiting withered leaves and fewer tillers .

What is the protein structure and domain organization of OsCASP1?

OsCASP1 contains four transmembrane domains with cytoplasmic N and C termini, characteristic of the CASP family proteins. These proteins show high conservation in their transmembrane domains, particularly the first (TM1) and the third (TM3) . A distinctive feature is the presence of conserved basic (Arg) residues in TM1 and acidic (Asp) residues in TM3, which are present in the vast majority of CASP-like proteins .

OsCASP1 belongs to the larger MARVEL (MAL and related proteins for vesicle trafficking and membrane link) protein family. CASPLs and MARVELs are predicted with high probability to be members of both families, indicating that CASPL and MARVEL domains are likely homologous . The complementary taxonomic distribution of species with predicted CASPL (DUF588 and PF04535) or MARVEL (PF01284) domains in opisthokonts and plants further supports their evolutionary relationship .

What phenotypes are associated with OsCASP1 knockout in rice?

OsCASP1 knockout in rice results in several distinct phenotypes:

Genetic analysis confirmed that a single recessive gene controls this mutant phenotype, and complementation studies demonstrated that introducing the wild-type OsCASP1 gene with its native promoter restored normal phenotype in the mutant plants . The mutant was named Oscasp1-3, further validating the direct relationship between OsCASP1 function and the observed phenotypic traits .

How does OsCASP1 function differ from Arabidopsis CASP proteins?

There are several key functional differences between rice OsCASP1 and Arabidopsis CASP proteins:

  • Genetic redundancy: In Arabidopsis, the CASP family consists of five members (CASP1-CASP5) that function redundantly in regulating Casparian strip formation. Single knockout mutants (atcasp1 or atcasp3) do not affect CS formation, and only the atcasp1 atcasp3 double mutant shows defects . In contrast, knockout of OsCASP1 alone in rice is sufficient to cause defects in CS formation, indicating less functional redundancy .

  • Timing of CS formation: The first appearance of CS in rice occurs earlier than in Arabidopsis, indicating different developmental timing .

  • Expression patterns: Arabidopsis CASPs show strictly endodermis-specific expression, while OsCASP1 is expressed more broadly in rice roots, including in the stele and sclerenchyma, particularly after salt treatment .

  • Propidium iodide (PI) permeability: PI is used to detect CS integrity in Arabidopsis, but rice roots can hinder (not prevent) PI entry into the stele, making this method less suitable for rice .

These differences highlight important species-specific adaptations in root barrier formation mechanisms between the model dicot Arabidopsis and the monocot crop rice.

What are the expression patterns of OsCASP1 in different rice tissues?

OsCASP1 displays a specific expression pattern in rice tissues:

  • Root-specific expression: OsCASP1 is highly upregulated at small lateral root tips (SLRs) and strongly expressed in roots .

  • Cell-type specificity: Within roots, OsCASP1 is expressed in multiple cell types including the endodermis, stele, and sclerenchyma, with enhanced expression in stele and sclerenchyma after salt treatment .

  • Co-expression patterns: OsCASP1 expression pattern is similar to that of OsMyb36a, OsMyb36b, and OsMyb36c transcription factors, which directly regulate OsCASP1 expression .

The expression pattern of OsCASP1 appears to be more consistent with that of OsMyb36a, OsMyb36b, and OsMyb36c compared to previous reports . This broader expression pattern in multiple root tissues suggests OsCASP1 may have functions beyond endodermis-specific CS formation, potentially explaining its diverse roles in nutrient homeostasis and stress adaptation.

What molecular mechanisms underlie OsCASP1's role in Casparian strip formation?

OsCASP1 functions through several molecular mechanisms in Casparian strip formation:

  • Membrane scaffold formation: OsCASP1 likely forms a transmembrane scaffold that recruits lignin biosynthetic enzymes to specific membrane domains where Casparian strips form . These CASP microdomains bring together reactive oxygen species (ROS)-producing NADPH oxidases with ROS-utilizing peroxidases, which are crucial for CS formation .

  • Lignin deposition control: Loss of OsCASP1 function leads to abnormal CS with uneven lignin deposition, particularly in regions far from SLR tips, suggesting that OsCASP1 regulates proper lignin deposition patterns in the endodermis .

  • Transcriptional regulation: OsCASP1 is directly regulated by OsMyb36 transcription factors, which can bind to the OsCASP1 promoter. Overexpression of OsMyb36a accelerates CS formation, whereas co-mutation of OsMyb36a/b/c delays CS formation .

  • Protein interactions: While direct evidence for physical interactions between OsCASP1 and cell wall enzymes remains indirect , the functional connection between OsCASP1 and lignin polymerization suggests protein-protein interactions similar to those documented in Arabidopsis.

The search results note that whether OsCASP1 forms a scaffold with itself or other OsCASPs in the Casparian Strip Domain (CSD) for CS biosynthesis requires further evidence .

How does OsCASP1 regulate suberin deposition in rice roots?

OsCASP1 plays a crucial role in regulating suberin deposition in rice roots:

Suberin is a hydrophobic biopolymer that forms a barrier to water and solute movement in plant roots. The proper deposition of suberin is essential for nutrient homeostasis and adaptation to the growth environment. The relationship between OsCASP1 and suberin deposition represents an important aspect of root barrier formation that differs from the primarily lignin-focused role of Arabidopsis CASPs.

What techniques are most effective for studying OsCASP1 localization and function in rice?

Several effective techniques have been documented for studying OsCASP1:

Genetic Modification Approaches:

  • CRISPR/Cas9 gene editing: Used to generate knockout mutants (oscasp1-1) with specific target sequences localized to exon 1 of the OsCASP1 gene .

  • Complementation constructs: OsCASP1pro:OsCASP1 containing the native promoter (1128 bp upstream) and coding sequence for restoring wild-type phenotype in mutants .

  • Reporter constructs: OsCASP1pro:OsCASP1-GUS and OsCASP1pro:OsCASP1-GFP for expression and localization studies .

  • Overexpression constructs: Using the maize ubiquitin promoter (Pubi-OsCASP1) for functional studies .

Visualization Techniques:

  • Whole-mount observation: Treatment with ClearSee solution followed by staining with Basic Fuchsin and Calcofluor White for visualizing CS structure in SLRs .

  • Cross-section observations: At various distances (7 mm, 10 mm, and 20 mm) from primary root tips to observe fluorescence patterns .

  • Fluorescence microscopy: For detecting GFP-tagged proteins and lignin autofluorescence .

Experimental Growth Systems:

  • Hydroponic culture: Using 1×Kimura B nutrient solution for controlled environmental studies and nutrient deficiency tests .

  • Field experiments: Growing F2 and F3 populations in experimental paddy fields for phenotypic analysis under natural conditions .

Table 1: Comparison of techniques for studying OsCASP1

TechniqueApplicationAdvantagesLimitations
CRISPR/Cas9Gene knockoutPrecise targeting, complete loss of functionPotential off-target effects
GUS reporterExpression analysisSensitive detection, tissue specificityLimited for protein localization
GFP fusionProtein localizationLive-cell imaging, subcellular localizationMay affect protein function
ClearSee + stainingCS visualizationWhole-mount observation of SLRsNot suitable for thick primary roots
PI stainingBarrier integrityStandard method in ArabidopsisNot reliable for rice roots

How do environmental stresses affect OsCASP1 expression and function?

Environmental stresses significantly influence OsCASP1 expression and function:

  • Salt stress response: OsCASP1 is strongly expressed in roots, especially in the stele and sclerenchyma, after salt treatment , suggesting upregulation under salt stress conditions.

  • Calcium stress adaptation: Overexpression of OsCASP1 improves calcium tolerance in rice , indicating a role in adaptation to calcium stress.

  • Nutrient deficiency response: OsCASP1 expression and function have been studied under nutrient deficiency conditions using hydroponic systems , suggesting involvement in nutrient stress responses.

  • Barrier function regulation: Environmental stresses likely affect OsCASP1's role in forming root barriers (Casparian strips and regulating suberin deposition), which control nutrient and ion uptake under different conditions .

The search results suggest that OsCASP1 plays an important role in nutrient homeostasis and adaptation to the growth environment . This environmental responsiveness makes OsCASP1 an interesting target for improving stress tolerance in rice.

What is the evolutionary relationship between rice OsCASP1 and other CASP/CASPL proteins?

The evolutionary analysis of CASP/CASPL proteins reveals:

  • Taxonomic distribution: CASP-like (CASPL) proteins are found in all major divisions of land plants and in green algae, with six proteins identified in green algae species .

  • Relationship to MARVEL proteins: CASPLs belong to the MARVEL protein family, with homologs outside the plant kingdom identified as MARVEL family members . They show complementary taxonomic distribution between plants and opisthokonts .

  • Domain conservation: These proteins show high conservation in transmembrane domains, particularly TM1 and TM3, with conserved basic (Arg) and acidic (Asp) residues respectively .

  • Classification: The CASP and CASP-like proteins in rice were obtained by searching the RAP-DB database with BlastP programs, and phylogenetic analysis was performed using MEGA X with the maximum likelihood method and JTT matrix-based model .

  • Domain annotations: CASPLs are annotated in UniProtKB as carrying a MARVEL-like domain (IPR021128), and in the Rice Annotation Project Database as DUF588 domain proteins .

This evolutionary conservation highlights the fundamental importance of CASP/CASPL proteins across plant species and suggests ancient origins of these membrane proteins in eukaryotic cells.

How does OsCASP1 integrate with other components of the Casparian strip regulatory network?

OsCASP1 functions within a complex regulatory network:

  • Transcriptional regulation: OsCASP1 expression is directly regulated by OsMyb36 transcription factors (OsMyb36a, OsMyb36b, and OsMyb36c), which bind to the OsCASP1 promoter . Overexpression of OsMyb36a accelerates CS formation, while co-mutation of OsMyb36a/b/c delays it .

  • Protein interactions: Based on Arabidopsis models, CASPs likely recruit enzymes and cofactors for lignin polymerization, including:

    • Respiratory burst oxidase homolog F (RBOHF) for ROS production

    • Enhanced suberin 1 (ESB1) for CS formation

    • Peroxidase 64 (PER64) for lignin polymerization

    • UCLACYANIN 1 (UCC1) as a cofactor

  • Signaling pathways: In Arabidopsis, a signaling pathway involving CIF1/2 peptides, SGN3 receptor kinase, and SGN1 cytoplasmic kinase monitors CS integrity . Similar components likely exist in rice but require further characterization.

  • Developmental coordination: The expression patterns and functions of OsCASP1 suggest coordination with root development processes, particularly lateral root formation and maturation .

This integrated network ensures proper CS formation and function, which is essential for nutrient homeostasis and environmental adaptation. The rice-specific components and interactions of this network represent an important area for further research.

What are the challenges in accurately detecting Casparian strip formation in rice compared to Arabidopsis?

Several technical challenges exist for CS research in rice:

  • Root anatomy differences: Rice has thicker primary roots that are not suitable for whole-mount observation, unlike the thinner and more transparent Arabidopsis roots .

  • Limitations of standard techniques: Propidium iodide (PI) penetration assay, commonly used in Arabidopsis, is not reliable for rice. Rice roots can hinder but not completely prevent PI entry into the stele, making this method inadequate for detecting CS integrity .

  • Timing disparities: CS appears earlier in rice than in Arabidopsis, requiring different time points for observation .

  • Lignin deposition patterns: Rice shows different patterns of abnormal CS with uneven lignin deposition, particularly in regions far from SLR tips , requiring careful interpretation.

  • Alternative methods needed: Researchers have developed rice-specific approaches focused on small lateral roots (SLRs) using ClearSee solution with Basic Fuchsin and Calcofluor White staining for whole-mount observation .

These challenges highlight the importance of developing rice-specific protocols rather than directly applying Arabidopsis-based methods, especially when comparing CS formation between these evolutionarily distant plant species.

How can genetic complementation approaches validate the function of OsCASP1?

Genetic complementation has been effectively used to validate OsCASP1 function:

  • Construct design: Researchers created complementation constructs containing:

    • The OsCASP1 promoter (1128 bp upstream including the whole intergenic sequence between Os04g0684200 and OsCASP1)

    • The complete OsCASP1 gene sequence

    • The construct was assembled using the In-Fusion cloning kit (Takara) into pCAMBIA-1300 digested with HindIII

  • Transformation approach: The construct was introduced into calli derived from F3 seeds of plants exhibiting the mutant phenotype .

  • Phenotypic evaluation: All transgenic lines carrying the OsCASP1 gene showed restored wild-type phenotype, confirming that OsCASP1 regulates leaf senescence and tiller development .

  • Additional reporter constructs: OsCASP1pro:OsCASP1-GUS and OsCASP1pro:OsCASP1-GFP constructs were also created to analyze expression patterns and protein localization .

  • Growth conditions assessment: Complemented lines were evaluated under both soil conditions in experimental paddy fields and in controlled hydroponic systems .

This comprehensive complementation approach provided strong evidence that the observed mutant phenotypes (withered leaves and few tillers) were directly caused by the loss of OsCASP1 function, validating its biological role in rice development.

How can OsCASP1 manipulation improve rice stress tolerance?

Manipulating OsCASP1 has potential applications for enhancing rice stress tolerance:

  • Calcium stress tolerance: Overexpression of OsCASP1 improves calcium tolerance in rice , suggesting potential for developing varieties with better performance in calcium-rich soils.

  • Salt stress adaptation: Given OsCASP1's upregulation in roots after salt treatment , modifying its expression could enhance salt tolerance - a critical trait for cultivation in increasingly saline agricultural lands.

  • Nutrient use efficiency: OsCASP1's role in nutrient homeostasis through root barrier formation suggests that optimizing its expression could improve nutrient acquisition efficiency, potentially reducing fertilizer requirements.

  • Water relations: Since OsCASP1 regulates suberin deposition , which affects water movement in roots, its manipulation could potentially improve drought tolerance or waterlogging adaptation.

  • Root system architecture: OsCASP1 mutants show phenotypic changes including fewer tillers , indicating that targeted manipulation might improve root system development for better resource acquisition.

The specific approaches for OsCASP1 manipulation could include:

  • Overexpression using constitutive or tissue-specific promoters

  • Precision breeding targeting natural variation in OsCASP1 expression or function

  • Gene editing to modify specific regulatory elements or protein domains

How do different OsCASP1 mutations affect nutrient transport in rice?

OsCASP1 mutations significantly impact nutrient transport processes:

  • Ion balance disruption: Loss of OsCASP1 function leads to altered ion balance in plants , suggesting compromised selective transport mechanisms.

  • Barrier integrity: Delayed Casparian strip formation in OsCASP1 mutants likely reduces the effectiveness of the apoplastic barrier, allowing uncontrolled movement of nutrients and potentially toxic elements between soil solution and vascular tissues .

  • Altered suberin patterns: Ectopic suberin deposition in OsCASP1 mutants would modify hydrophobic barriers in roots, changing water and solute movement patterns .

  • Nutrient sensitivity: OsCASP1 mutants were studied under both soil conditions and in hydroponic experiments with 1×Kimura B nutrient solution to test sensitivity to nutrient deficiency , suggesting altered responses to different nutrient regimes.

  • Methodological approaches: The sensitivity of OsCASP1 mutants to nutrient deficiency was investigated by growing seedlings in nutrient solution in a growth cabinet with controlled photoperiod (28°C/14 h light and 28°C/10 h dark) .

While specific nutrient transport measurements are not detailed in the provided search results, the fundamental role of OsCASP1 in root barrier formation strongly implies significant effects on nutrient transport processes. Further research using techniques like radioactive tracer studies or elemental analysis would help quantify these effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.