Recombinant Oryza sativa subsp. japonica CASP-like protein Os05g0344400 (Os05g0344400, LOC_Os05g27790)

Shipped with Ice Packs
In Stock

Description

The CASP Protein Family

The CASP-like protein Os05g0344400 belongs to the larger family of CASP and CASP-like (CASPL) proteins, which are evolutionarily conserved across plant species. These proteins function as key structural components in the formation of specialized membrane domains that direct cell wall modifications . The CASP protein family has been identified in all major divisions of land plants as well as in green algae, with homologs outside the plant kingdom identified as members of the MARVEL protein family .

In plants, CASPs show remarkable stability in their membrane domains, presenting the characteristics of a membrane scaffold. When ectopically expressed, most CASPLs can integrate into the CASP membrane domain, suggesting a shared propensity to form transmembrane scaffolds . Research has shown that the extracellular loops of these proteins are not necessary for generating the scaffold structure, as CASP1 can still localize correctly when either one of the extracellular loops is deleted .

Role in Casparian Strip Formation

The primary biological function of CASP proteins involves mediating the deposition of Casparian strips in plant endodermal cells. Casparian strips are specialized cell wall impregnations that form a barrier in the root endodermis, controlling the movement of water and solutes between the soil solution and the vascular tissues of the plant .

CASP proteins act by recruiting the lignin polymerization machinery to specific sites on the plasma membrane. They form a membrane "fence" referred to as the Casparian strip membrane domain (CSD), which shows extremely low turnover once established . These proteins make a plasma membrane diffusion barrier and direct the modification of the cell wall that juxtaposes their membrane domain .

In rice specifically, OsCASP1 (which is closely related to the CASP-like protein Os05g0344400) is required for Casparian strip formation in endodermal cells. OsCASP1 can form complexes with itself and with OsCASP2, which can lead to ectopic protein accumulation when expressed under control of the 35S promoter .

Specialized Function in Rice

Rice has a more complex root structure than the model plant Arabidopsis, which enables it to adapt to its semi-aquatic growing conditions. The radial structure of rice roots includes the epidermis, exodermis, sclerenchyma, midcortex, endodermis, and stele from the outside inward . This structural complexity requires specialized deposition patterns of lignin and suberin, where CASP proteins play a crucial role.

Research has shown that OsCASP1, which shares high sequence similarity with the CASP-like protein Os05g0344400, is highly upregulated at small lateral root tips and is strongly expressed in roots, especially in the stele and sclerenchyma, after salt treatment . This expression pattern indicates a specialized function in rice adaptation to environmental stresses, particularly salt stress.

Physiological Impact of CASP Mutation

Studies on OsCASP1 mutants have provided significant insights into the function of CASP proteins in rice. Three different mutants—Oscasp1-3 (a natural mutant from a paddy field), Oscasp1-4 (a CRISPR/Cas9 mutant), and Oscasp1-1 (with Nipponbare background)—have been used in research to elucidate the role of this protein .

The loss of OsCASP1 function leads to several physiological and developmental impacts, summarized in Table 2.

Table 2: Phenotypic and Physiological Effects of OsCASP1 Mutation in Rice

Level of ImpactObserved Effects
MorphologicalWithered leaves, fewer tillers compared to wild type
DevelopmentalDelayed Casparian strip formation in small lateral roots
CellularUneven lignin deposition in small lateral roots
BiochemicalAltered expression of genes involved in suberin biosynthesis
Tissue-specificModified deposition of suberin in the endodermis and sclerenchyma
PhysiologicalIon imbalance in plants, reduced nutrient uptake
Stress responseReduced tolerance to salt stress

These findings indicate that OsCASP1 (and by extension, related CASP-like proteins) plays an important role in nutrient homeostasis and adaptation to environmental conditions, particularly salt stress. The altered deposition of suberin and lignin in mutant plants affects the barrier properties of the root system, leading to physiological imbalances and reduced stress tolerance .

Applications in Plant Science Research

The recombinant CASP-like protein Os05g0344400 serves as a valuable tool for various research applications in plant science, including:

  1. Structural studies of membrane scaffold proteins

  2. Investigation of protein-protein interactions involved in Casparian strip formation

  3. Analysis of cell wall modification processes

  4. Studies on root development and barrier function

  5. Research on plant adaptation to environmental stresses, particularly salt stress

  6. Comparative studies of root structure and function across plant species

The availability of this recombinant protein facilitates such research by providing a purified, standardized material for experimental applications.

CASP/CASPL Proteins Across Plant Species

CASP and CASPL proteins form a large family that is evolutionarily conserved across plant species. Phylogenetic analysis using the Molecular Evolutionary Genetic Analysis program (MEGA X) with the maximum likelihood method and JTT matrix-based model has been employed to study the relationships among these proteins .

In rice, there are 6 OsCASPs and 28 OsCASPLs, indicating a significant expansion of this protein family compared to other plants . This expansion may reflect the specialized adaptations of rice to its semi-aquatic environment and the complexity of its root structure.

Functional Conservation and Divergence

Research suggests that while the core function of CASP proteins in forming membrane scaffolds and directing cell wall modifications is conserved across plant species, there are important functional divergences related to species-specific adaptations. In Arabidopsis, at least twelve AtCASPLs can reach the plasma membrane under the control of the AtCASP1 promoter, with nine clearly locating at the Casparian strip domain just like AtCASPs .

Interestingly, CASPL proteins appear to have diverse functions beyond Casparian strip formation. For example, AtCASPL4C1 knockout plants show earlier flowering compared to wild type, and overexpressing CICASPL (the ortholog of AtCASPL4C1 in Citrullus lanatus) results in increased sensitivity to cold stress in Arabidopsis . This functional diversity highlights the evolutionary adaptation of CASP/CASPL proteins to serve various roles in plant development and stress response.

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format we have in stock, we are happy to accommodate specific format requirements. Please indicate your preference when placing the order and we will fulfill it to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us and we will prioritize its development for your order.
Synonyms
Os05g0344400; LOC_Os05g27790; B1036C05.1; P0015F11.14; CASP-like protein 4B4; OsCASPL4B4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Oryza sativa subsp. japonica (Rice)
Target Names
Os05g0344400
Target Protein Sequence
MSAAVAASSGAPAADVEKGAAAADANVDGGGAPAAAAASGEGVVSAVVRRWRRQDLLEKS GSALRVAAWAFSLLAFVVMGANDHGDWRQFEHYEEYRYVVAIGVLAFIYTTLQLVRHGVR LTGGQDLQGKVAVLVDFAGDQVTAYLLMSAVSAAIPITNRMREGADNVFTDSSAASISMA FFAFLCLALSALVSGFKLAKQTYI
Uniprot No.

Target Background

Database Links
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are CASP-like proteins and what is their general function in plants?

CASP-like proteins belong to a larger family of membrane proteins that includes the Casparian strip membrane domain (CASP) proteins. Originally identified as alternatively spliced products of genes such as CUTL1, CASP proteins were found to be membrane-associated proteins rather than nuclear proteins as initially hypothesized . These proteins are characterized by the presence of multiple transmembrane domains (typically four) and are localized to various cellular compartments, including the plasma membrane .

CASP-like proteins in rice, including Os05g0344400, share structural features with their Arabidopsis counterparts but may have evolved species-specific functions related to rice physiology and development.

How are CASP-like proteins related to Casparian strip formation?

The Casparian strip is a specialized cell wall modification in the endodermis of plant roots that forms a barrier to control apoplastic movement of water and solutes. The core CASP proteins (CASP1/2/3/4/5) in Arabidopsis have been definitively shown to mediate Casparian strip formation . These proteins localize to the plasma membrane at the site of Casparian strip formation and serve as scaffolds for the deposition of lignin, a key component of the Casparian strip.

CASP-like proteins, including Os05g0344400, share structural similarities with the core CASP proteins but may have diverged functionally. Interestingly, studies of AtCASPL4C1 (the Arabidopsis ortholog of a related CASP-like protein) showed that knockout plants did not display significant alterations in Casparian strip formation in roots, despite showing changes in expression of CASP1-5 genes . This suggests that while CASP-like proteins may influence the expression of core CASP genes, they may not be directly involved in Casparian strip formation.

The relationship between Os05g0344400 and Casparian strip formation in rice has not been fully elucidated, but based on homology with Arabidopsis CASP-like proteins, it may play indirect roles in regulating this process or may have evolved entirely different functions.

What expression patterns does CASP-like protein Os05g0344400 show in rice tissues?

While specific expression data for Os05g0344400 is limited in the provided search results, insights can be drawn from studies of related CASP-like proteins. In Arabidopsis, the orthologous gene AtCASPL4C1 is widely expressed in various organs and is particularly induced by cold stress . Expression analysis using β-glucuronidase (GUS) reporter systems has been valuable in determining the tissue-specific expression patterns of these genes.

Based on comparisons with other CASP family members, Os05g0344400 is likely expressed in multiple tissues including roots, shoots, and reproductive organs. Transcriptomic analyses of CASP family genes in Arabidopsis have shown that many CASP and CASP-like genes are differentially regulated under various abiotic stresses . It is reasonable to hypothesize that Os05g0344400 may similarly show stress-responsive expression patterns in rice, particularly under cold stress conditions.

Researchers interested in defining the precise expression patterns of Os05g0344400 should consider employing promoter-GUS fusion analyses, quantitative PCR, or RNA-seq approaches across different tissues and under various stress conditions.

How are CASP and CASP-like proteins evolutionarily conserved across plant species?

CASP and CASP-like proteins show significant evolutionary conservation across plant species, suggesting their fundamental importance in plant physiology. Phylogenetic analyses have revealed that CASP-like proteins can be grouped into distinct subfamilies, with Os05g0344400 belonging to one of these evolutionary lineages .

Interestingly, while mammalian CASP was originally identified as an alternatively spliced product of the CUTL1 gene, studies have shown that both C. elegans and mammalian homologues of CASP can be generated from a single gene . This suggests an ancient evolutionary origin for these proteins.

In the context of rice, CASP-like proteins such as Os05g0344400 and Os11g0649700 represent rice-specific adaptations of this conserved protein family . Comparative genomic analyses between rice, Arabidopsis, and other plant species have shown that while the core structural features of CASP-like proteins (such as the presence of four transmembrane domains) are conserved, there are species-specific variations that likely reflect adaptations to different environmental conditions and physiological requirements.

The conservation of CASP-like proteins across diverse plant species, from rice to Arabidopsis to watermelon, underscores their fundamental importance in plant biology and suggests that Os05g0344400 likely plays crucial roles in rice physiology.

What experimental approaches are recommended for studying the function of Os05g0344400 in rice?

To elucidate the function of Os05g0344400 in rice, researchers should employ a multifaceted experimental approach:

  • Genetic Modification Strategies:

    • CRISPR/Cas9-mediated knockout to generate loss-of-function mutants

    • Overexpression under constitutive (e.g., CaMV 35S) or inducible promoters

    • Complementation of knockout lines with wildtype or mutated versions of the gene

  • Localization Studies:

    • Generate translational fusions with fluorescent proteins (e.g., GFP) to determine subcellular localization

    • Use co-localization with organelle markers to confirm membrane association

    • Employ immunolocalization with specific antibodies for tissue-level expression patterns

  • Expression Analysis:

    • Promoter-GUS fusion analysis to determine tissue-specific expression patterns

    • Quantitative PCR to measure expression under various developmental stages and stress conditions

    • RNA-seq for genome-wide expression profiling in wildtype versus knockout/overexpression lines

  • Physiological Characterization:

    • Analyze growth parameters, biomass accumulation, and developmental timing

    • Assess response to abiotic stresses, particularly cold stress, given the known role of CASP-like proteins in cold tolerance

    • Examine root development and function, including hydraulic conductivity and nutrient uptake

  • Biochemical Approaches:

    • Yeast two-hybrid or co-immunoprecipitation to identify protein interaction partners

    • Proteomics analysis to identify post-translational modifications

    • Membrane topology analysis using protease protection assays

  • Transformation Methods:

    • Utilize immature-embryo methods with Agrobacterium for genetic transformation, which has been optimized for various Oryza species

These approaches should be integrated to develop a comprehensive understanding of Os05g0344400 function in rice.

How do knockout and overexpression of CASP-like proteins affect plant phenotypes?

Studies of CASP-like proteins in various plant species have revealed significant phenotypic effects of genetic manipulation. In Arabidopsis, knockout of AtCASPL4C1 (an ortholog of a CASP-like protein) resulted in:

  • Growth Enhancement:

    • Altered growth dynamics with faster growth rates

    • Increased biomass (dry weight) accumulation

    • Earlier flowering compared to wild type plants

  • Stress Response Alterations:

    • Elevated tolerance to cold stress

    • Potentially modified responses to other abiotic stressors

Conversely, overexpression of the watermelon ClCASPL in Arabidopsis led to:

  • Growth Inhibition:

    • Reduced growth rate compared to knockout lines

    • Decreased biomass accumulation

  • Stress Response Alterations:

    • Increased sensitivity to cold stress

These observations suggest that CASP-like proteins function as negative regulators of plant growth and development, while also modulating stress responses, particularly to cold.

What role do CASP-like proteins play in abiotic stress responses, particularly cold tolerance?

CASP-like proteins have emerged as important regulators of plant responses to abiotic stresses, with particularly strong evidence for their involvement in cold stress tolerance:

  • Transcriptional Regulation Under Stress:

    • CASP-like genes show significant transcriptional regulation under various abiotic stresses

    • Cold stress specifically induces the expression of certain CASP-like genes, such as ClCASPL in watermelon and AtCASPL4C1 in Arabidopsis

  • Negative Regulation of Cold Tolerance:

    • Knockout of AtCASPL4C1 in Arabidopsis enhances cold tolerance

    • Overexpression of ClCASPL in Arabidopsis increases sensitivity to cold stress

  • Molecular Mechanisms:

    • CASP-like proteins may regulate cell membrane properties under cold stress

    • They potentially influence the expression of cold-responsive genes through unknown signaling mechanisms

    • Their role in vascular tissue may affect water and nutrient transport under stress conditions

  • Species-Specific Adaptations:

    • Different plant species have evolved specific adaptations of CASP-like proteins to their environmental conditions

    • Rice, as a tropical/subtropical crop, may utilize Os05g0344400 in unique ways for temperature stress management

Researchers investigating Os05g0344400's role in stress responses should consider comparative stress treatments across multiple abiotic stressors (cold, drought, salt, heat) and evaluate both physiological and molecular responses in wild-type versus genetically modified plants.

How can genetic transformation techniques be optimized for studying Os05g0344400 function?

Optimizing genetic transformation for studying Os05g0344400 requires consideration of several key factors:

  • Transformation Method Selection:

    • The immature-embryo method using Agrobacterium has been successfully applied to various Oryza species and represents a viable approach for rice transformation

    • This method has been optimized for 51 accessions across 11 Oryza species, providing a strong foundation for transformation of japonica rice varieties

  • Tissue Culture Optimization:

    • Callus formation from immature embryos and regeneration of plantlets require optimized culture conditions

    • Studies have shown that 90 out of 192 representative wild Oryza accessions can form calluses from immature embryos and regenerate plantlets under appropriate conditions

  • Construct Design Considerations:

    • For knockout studies: CRISPR/Cas9 constructs targeting conserved regions of Os05g0344400, particularly within transmembrane domains

    • For overexpression: Full-length cDNA under control of constitutive (CaMV 35S, Ubiquitin) or inducible promoters

    • For localization studies: C-terminal fusions with fluorescent proteins are recommended to avoid disrupting the N-terminal signaling sequences

  • Selection Strategy:

    • Employ appropriate selection markers (hygromycin, kanamycin, etc.) based on the rice variety being transformed

    • Implement molecular screening (PCR, sequencing) to confirm successful transformation

  • Controls and Complementation:

    • Include vector-only controls to account for transformation effects

    • Generate complementation lines by reintroducing the wild-type gene into knockout backgrounds

    • Consider creating point mutations in key residues to assess their functional significance

  • Specific Considerations for Os05g0344400:

    • Focus on conserved regions when designing targeting constructs

    • Consider mutating the predicted transmembrane domains to assess their functional importance

    • For promoter studies, include approximately 2kb upstream of the transcription start site to capture regulatory elements

By optimizing these aspects of genetic transformation, researchers can effectively generate the genetic resources needed to comprehensively characterize Os05g0344400 function in rice.

What are the current challenges in elucidating the non-Casparian strip functions of CASP-like proteins?

Researchers face several significant challenges when investigating the non-Casparian strip functions of CASP-like proteins like Os05g0344400:

  • Functional Redundancy:

    • The presence of multiple CASP-like genes in plant genomes (39 in Arabidopsis) suggests potential functional redundancy

    • Single gene knockouts may show subtle phenotypes due to compensation by related family members

    • Creating and characterizing multiple knockout lines is resource-intensive but may be necessary

  • Pleiotropic Effects:

    • CASP-like proteins likely have diverse functions in different tissues and developmental stages

    • Distinguishing primary from secondary effects in knockout/overexpression lines requires careful experimental design

    • Tissue-specific or inducible gene manipulation approaches may help address this challenge

  • Limited Knowledge of Interacting Partners:

    • The molecular networks in which CASP-like proteins function remain poorly characterized

    • Identifying protein-protein interaction partners is essential but technically challenging for membrane proteins

    • Advanced proteomics approaches optimized for membrane proteins are needed

  • Species-Specific Functions:

    • Functions established in model plants like Arabidopsis may not directly translate to crop species like rice

    • Evolutionary divergence may have led to novel functions in different plant lineages

    • Comparative functional studies across species are needed

  • Technical Challenges:

    • Difficulties in raising specific antibodies against highly similar family members

    • Challenges in expressing and purifying membrane proteins for biochemical studies

    • Need for sophisticated imaging techniques to visualize membrane dynamics and protein interactions

  • Integration of Data:

    • Connecting molecular mechanisms to whole-plant phenotypes requires integrative approaches

    • Linking gene expression, protein localization, interactome data, and physiological responses remains challenging

Addressing these challenges requires multidisciplinary approaches and integration of data from various experimental systems to build a comprehensive understanding of Os05g0344400 function beyond potential roles in Casparian strip formation.

How does the transmembrane domain structure influence the function of CASP-like proteins?

The transmembrane domain (TMD) structure is central to the function of CASP-like proteins, including Os05g0344400:

  • Structural Features and Conservation:

    • CASP-like proteins typically contain four predicted transmembrane domains

    • These domains show evolutionary conservation across species, suggesting functional importance

    • In CASP proteins, a conserved histidine residue in the TMD is necessary for their function

  • Membrane Anchoring and Topology:

    • The TMDs anchor CASP-like proteins in the plasma membrane or other cellular membranes

    • The topology (orientation of the protein within the membrane) determines which domains face the cytoplasm versus the extracellular/luminal space

    • This orientation influences potential interaction partners and function

  • Functional Significance:

    • In classical CASP proteins, the TMDs are crucial for proper localization to the Casparian strip domain

    • Studies of giantin and golgin-84 (related TMD proteins) show that the C-terminal TMD is essential for their function

    • The conserved histidine in the TMD of yeast homolog Coy1p is necessary for its activity in cells lacking Gos1p, suggesting direct involvement of the TMD in protein function

  • Potential Mechanisms in Os05g0344400:

    • The TMDs of Os05g0344400 likely determine its subcellular localization

    • They may facilitate interactions with other membrane proteins in signaling complexes

    • The TMDs could respond to membrane fluidity changes during stress, particularly cold stress

    • They potentially mediate conformational changes in response to environmental signals

  • Experimental Approaches to Study TMD Function:

    • Site-directed mutagenesis of conserved residues within TMDs

    • Domain swapping experiments with related CASP-like proteins

    • Membrane topology mapping using protease protection assays

    • Fluorescence resonance energy transfer (FRET) studies to analyze protein-protein interactions within membranes

Understanding how the TMD structure influences Os05g0344400 function will provide crucial insights into its molecular mechanisms and potential applications in crop improvement.

What protein-protein interactions have been identified for CASP-like proteins in rice?

While specific protein-protein interactions for Os05g0344400 have not been extensively characterized in the provided search results, insights can be drawn from studies of related CASP proteins and extrapolated to form hypotheses about Os05g0344400:

  • Known CASP Protein Interactions:

    • CASP1-5 proteins in Arabidopsis interact with each other to form a platform for Casparian strip formation

    • They interact with lignin biosynthesis enzymes to facilitate lignin deposition in the Casparian strip

    • This suggests that CASP-like proteins may similarly form homo- or heteromeric complexes

  • Potential Interaction Partners for Os05g0344400:

    • Other CASP-like proteins in rice, forming functional complexes

    • Stress-responsive signaling proteins, particularly those involved in cold response pathways

    • Membrane remodeling proteins that modify membrane properties under stress conditions

    • Transcriptional regulators that mediate stress-responsive gene expression

  • Methodological Approaches for Identification:

    • Yeast two-hybrid screening using the cytoplasmic domains of Os05g0344400

    • Co-immunoprecipitation followed by mass spectrometry

    • Split-ubiquitin assays specifically designed for membrane protein interactions

    • Proximity labeling approaches such as BioID or APEX to identify proteins in the vicinity of Os05g0344400

  • Interactome Data Integration:

    • Network analysis integrating transcriptomic data under various stress conditions

    • Comparative interactome analysis across different plant species

    • Correlation of protein-protein interaction data with phenotypic effects of gene manipulation

  • Functional Validation:

    • Genetic analysis of double mutants (Os05g0344400 plus interacting partner)

    • Bimolecular fluorescence complementation (BiFC) to confirm interactions in planta

    • Functional assays to determine the physiological significance of identified interactions

Identifying the protein interaction network of Os05g0344400 will be crucial for understanding its molecular function and place in stress response pathways. Researchers should consider employing complementary approaches to build a comprehensive interactome map for this protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.